Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	Pt-UBC1.2,HUPB903
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G02760 285 / 1e-100 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) AT1G14400 284 / 5e-100 ATUBC1, UBC1 UBIQUITIN CONJUGATING ENZYME 1, ubiquitin carrier protein 1 (.1.2) AT5G62540 255 / 7e-89 UBC3 ubiquitin-conjugating enzyme 3 (.1) AT4G27960 140 / 2e-43 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT1G64230 139 / 7e-43 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT5G53300 139 / 1e-42 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT5G41700 138 / 2e-42 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT3G08690 135 / 2e-41 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT2G16740 134 / 4e-41 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT5G56150 134 / 8e-41 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G064400 [exp] 286 / 3e-101 AT2G02760 313 / 1e-111 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.015G064000 [exp] 286 / 6e-101 AT2G02760 284 / 3e-100 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Potri.003G136200 [exp] 138 / 1e-42 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.006G110200 [exp] 138 / 1e-42 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.016G138900 [exp] 138 / 1e-42 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.015G023300 [exp] 138 / 2e-42 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 138 / 2e-42 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.001G094900 [exp] 138 / 2e-42 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.019G131400 [exp] 137 / 4e-42 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036727 [exp] 282 / 3e-99 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10037203 [exp] 282 / 3e-99 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10013263 [exp] 281 / 5e-99 AT2G02760 304 / 6e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10030786 [exp] 281 / 5e-99 AT2G02760 305 / 2e-108 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1) Lus10022726 [exp] 139 / 6e-43 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10021385 [exp] 139 / 6e-43 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 139 / 6e-43 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 139 / 1e-42 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 139 / 1e-42 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014942 [exp] 139 / 1e-42 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF00179 [poplar] [flax] UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence Show only first row Show all	>Potri.019G039200.4 pacid=42773941 polypeptide=Potri.019G039200.4.p locus=Potri.019G039200 ID=Potri.019G039200.4.v4.1 annot-version=v4.1 ATGTCAACCCCAGCCAGGAAGAGGTTGATGAGGGATTTCAAGAGGCTGCAGCAGGATCCACCTGCCGGCATCAGTGGTGCTCCCCAAGACAACAACATCA TGCTTTGGAACGCTGTTATTTTCGGACCTGATGATACTCCATGGGATGGAGGGACGTTTAAGTTGACTCTTCAATTCACGGAGGATTATCCGAATAAACC TCCAACAGTCCGATTTGTTTCACGGATGTTTCATCCAAACATTTATGCAGATGGAAGTATATGCTTGGACATCTTACAAAATCAGTGGAGTCCGATATAT GATGTTGCTGCTATACTTACCTCCATCCAGTCTCTGCTCTGTGATCCAAACCCAAATTCCCCAGCAAACTCTGAAGCCGCTCGCATGTTCAGTGAGACTA AGCGGGAGTACAACCGCAGAGTTCGTGAGGTAGTGGAGCAGAGCTGGACGGCTGACTGA
AA sequence Show only first row Show all	>Potri.019G039200.4 pacid=42773941 polypeptide=Potri.019G039200.4.p locus=Potri.019G039200 ID=Potri.019G039200.4.v4.1 annot-version=v4.1 MSTPARKRLMRDFKRLQQDPPAGISGAPQDNNIMLWNAVIFGPDDTPWDGGTFKLTLQFTEDYPNKPPTVRFVSRMFHPNIYADGSICLDILQNQWSPIY DVAAILTSIQSLLCDPNPNSPANSEAARMFSETKREYNRRVREVVEQSWTAD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G02760		ATUBC2	ubiquitin-conjugating enzyme 2...		Potri.019G039200 [exp]	0	1	Pt-UBC1.2,HUPB903
AT5G50870		UBC27	ubiquitin-conjugating enzyme 2...		Potri.015G103400 [exp]	2.00	0.8563
AT3G24010		ATING1	ARABIDOPSIS THALIANA INHIBITOR...		Potri.003G174000 [exp]	6.92	0.8100
AT5G14670		ATARFA1B	ADP-ribosylation factor A1B (....		Potri.013G005500 [exp]	7.07	0.8235
AT1G51200			A20/AN1-like zinc finger famil...		Potri.006G056500 [exp]	7.48	0.8499
AT1G70330		"ENT1,AT", ENT1...	equilibrative nucleotide trans...		Potri.012G058900 [exp]	7.93	0.7805
AT4G27660			unknown protein		Potri.012G006501 [exp]	11.53	0.8196
AT2G28370			Uncharacterised protein family...		Potri.009G014600 [exp]	12.72	0.8198
AT2G40110			Yippee family putative zinc-bi...		Potri.010G190000 [exp]	14.86	0.7967
AT5G03300		ADK2	adenosine kinase 2 (.1)		Potri.008G038100 [exp]	17.57	0.8288
					Potri.008G100650 [exp]	19.23	0.7608

Compare expression of checked genes

Potri.019G039200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.