Potri.019G041400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G16650 193 / 6e-65 Chaperone DnaJ-domain superfamily protein (.1)
AT2G33735 102 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1)
AT4G28480 73 / 3e-16 DNAJ heat shock family protein (.1.2)
AT3G08910 73 / 3e-16 DNAJ heat shock family protein (.1)
AT5G01390 72 / 3e-16 DNAJ heat shock family protein (.1.2.3.4)
AT3G62600 72 / 6e-16 ATERDJ3B DNAJ heat shock family protein (.1)
AT1G56300 69 / 1e-15 Chaperone DnaJ-domain superfamily protein (.1)
AT2G20560 70 / 5e-15 DNAJ heat shock family protein (.1)
AT1G59725 70 / 5e-15 DNAJ heat shock family protein (.1)
AT1G24120 69 / 2e-14 ARL1 ARG1-like 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G078200 221 / 3e-76 AT5G16650 198 / 6e-67 Chaperone DnaJ-domain superfamily protein (.1)
Potri.002G103900 136 / 3e-42 AT2G33735 147 / 2e-46 Chaperone DnaJ-domain superfamily protein (.1)
Potri.018G034600 74 / 2e-16 AT5G25530 410 / 8e-144 DNAJ heat shock family protein (.1)
Potri.008G123200 74 / 2e-16 AT1G68370 670 / 0.0 ALTERED RESPONSE TO GRAVITY 1, Chaperone DnaJ-domain superfamily protein (.1)
Potri.014G122600 73 / 4e-16 AT3G62600 565 / 0.0 DNAJ heat shock family protein (.1)
Potri.006G246700 73 / 4e-16 AT5G25530 394 / 1e-137 DNAJ heat shock family protein (.1)
Potri.008G193500 72 / 8e-16 AT1G24120 568 / 0.0 ARG1-like 1 (.1)
Potri.017G016100 72 / 8e-16 AT2G20560 420 / 7e-148 DNAJ heat shock family protein (.1)
Potri.007G136700 72 / 8e-16 AT2G20560 416 / 5e-146 DNAJ heat shock family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014901 81 / 8e-21 AT2G33735 85 / 2e-22 Chaperone DnaJ-domain superfamily protein (.1)
Lus10040535 81 / 2e-20 AT2G33735 84 / 1e-21 Chaperone DnaJ-domain superfamily protein (.1)
Lus10027803 75 / 7e-17 AT3G08910 504 / 0.0 DNAJ heat shock family protein (.1)
Lus10005033 75 / 7e-17 AT3G08910 503 / 0.0 DNAJ heat shock family protein (.1)
Lus10029862 72 / 7e-17 AT1G56300 201 / 9e-67 Chaperone DnaJ-domain superfamily protein (.1)
Lus10020685 72 / 8e-17 AT1G56300 200 / 1e-66 Chaperone DnaJ-domain superfamily protein (.1)
Lus10013981 73 / 3e-16 AT2G20560 488 / 8e-175 DNAJ heat shock family protein (.1)
Lus10005113 72 / 7e-16 AT1G68370 688 / 0.0 ALTERED RESPONSE TO GRAVITY 1, Chaperone DnaJ-domain superfamily protein (.1)
Lus10017687 71 / 3e-15 AT2G20560 551 / 0.0 DNAJ heat shock family protein (.1)
Lus10008109 70 / 6e-15 AT5G25530 401 / 1e-132 DNAJ heat shock family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0392 Chaperone-J PF00226 DnaJ DnaJ domain
Representative CDS sequence
>Potri.019G041400.2 pacid=42773138 polypeptide=Potri.019G041400.2.p locus=Potri.019G041400 ID=Potri.019G041400.2.v4.1 annot-version=v4.1
ATGGAAGGCAATGAAAACACCACTCAAAAGGATTACTACAAAATTTTGGAGGTTGATTATGATGCAACAGATGAGAAGATAAGACTAAATTACCGAAGGC
TTGCATTGAAGTGGCATCCTGATAAGCACAAGGGGGATAATGCAGTTACTACCAAATTTCAAGAGATTAACGAAGCTTACAATGTATTGAGGGATCCAGA
TAAACGCTTCGATTATGACTTAACTGGAATATATGAGATTGATAAGTATACTTTGCGGGAATATCTGACCAGATTTAAAGGAATGATACTTACGTGCAAT
GGTCTTGGTATTGGTAATACATCAATATGGACCCAGCAACTGACTGAAATCAAAGAGTTTGCAGAGAAATAA
AA sequence
>Potri.019G041400.2 pacid=42773138 polypeptide=Potri.019G041400.2.p locus=Potri.019G041400 ID=Potri.019G041400.2.v4.1 annot-version=v4.1
MEGNENTTQKDYYKILEVDYDATDEKIRLNYRRLALKWHPDKHKGDNAVTTKFQEINEAYNVLRDPDKRFDYDLTGIYEIDKYTLREYLTRFKGMILTCN
GLGIGNTSIWTQQLTEIKEFAEK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G16650 Chaperone DnaJ-domain superfam... Potri.019G041400 0 1
AT1G60000 RNA-binding (RRM/RBD/RNP motif... Potri.010G065600 6.70 0.9543 RNP1.1
AT2G35500 SKL2 shikimate kinase-like 2, shiki... Potri.003G096600 8.36 0.9438
AT1G15140 FAD/NAD(P)-binding oxidoreduct... Potri.010G116500 10.09 0.9474
AT2G41680 NTRC NADPH-dependent thioredoxin re... Potri.006G049100 11.13 0.9463
AT5G27290 unknown protein Potri.013G029000 18.46 0.9361
AT5G03940 SRP54CP, CPSRP5... SIGNAL RECOGNITION PARTICLE 54... Potri.006G211500 21.07 0.9468 Pt-FFC.2
AT2G28605 Photosystem II reaction center... Potri.007G100800 22.97 0.9142
AT5G52440 HCF106 HIGH CHLOROPHYLL FLUORESCENCE ... Potri.015G147100 33.22 0.9438 Pt-HCF106.1
AT3G11945 PDS2, ATHST PHYTOENE DESATURATION 2, homog... Potri.006G197600 36.00 0.9326
AT5G55220 trigger factor type chaperone ... Potri.015G065900 40.60 0.9349

Potri.019G041400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.