Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27630 61 / 4e-13 GTG2 GPCR-type G protein 2 (.1.2.3) AT1G64990 61 / 5e-13 GTG1 GPCR-type G protein 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G077700 [exp] 67 / 6e-15 AT4G27630 691 / 0.0 GPCR-type G protein 2 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009531 [exp] 68 / 2e-15 AT4G27630 719 / 0.0 GPCR-type G protein 2 (.1.2.3) Lus10020351 [exp] 67 / 3e-15 AT4G27630 766 / 0.0 GPCR-type G protein 2 (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12430 [poplar] [flax] ABA_GPCR Abscisic acid G-protein coupled receptor
Representative CDS sequence Show only first row Show all	>Potri.019G042201.1 pacid=42774588 polypeptide=Potri.019G042201.1.p locus=Potri.019G042201 ID=Potri.019G042201.1.v4.1 annot-version=v4.1 ATGCAGTGCTTCTTTGCGGATTCCAGAGTTGGGAGTGGATCTTCAAGCAATACTGTACTTTTCCTGTCTGAAATTATGGGAATGTACTTTGTCTCTTCTA TACTACTGATAAGAAAACGCTTAGCAACTGAGTACAGGATAATCATAACAGAAGTCTAG
AA sequence Show only first row Show all	>Potri.019G042201.1 pacid=42774588 polypeptide=Potri.019G042201.1.p locus=Potri.019G042201 ID=Potri.019G042201.1.v4.1 annot-version=v4.1 MQCFFADSRVGSGSSSNTVLFLSEIMGMYFVSSILLIRKRLATEYRIIITEV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G27630		GTG2	GPCR-type G protein 2 (.1.2.3)		Potri.019G042201 [exp]	0	1
AT2G37150			RING/U-box superfamily protein...		Potri.008G041201 [exp]	12.32	0.8942
AT3G28430			unknown protein		Potri.006G204600 [exp]	16.79	0.8849
AT3G17380			TRAF-like family protein (.1)		Potri.017G049100 [exp]	21.84	0.8757
AT2G39550		GGB, ATGGT-IB, ...	GERANYLGERANYLTRANSFERASE-I BE...		Potri.008G054500 [exp]	22.13	0.8752	Pt-ATGGT.1
AT5G13260			unknown protein		Potri.003G164100 [exp]	26.53	0.8770
AT2G20300		ALE2	Abnormal Leaf Shape 2, Protein...		Potri.002G254600 [exp]	32.86	0.8685
AT5G53860		EMB64, EMB2737	EMBRYO DEFECTIVE 64, embryo de...		Potri.001G398900 [exp]	33.04	0.8710
AT1G32700			PLATZ transcription factor fam...		Potri.016G097100 [exp]	37.88	0.7726
AT4G40045			unknown protein		Potri.008G025700 [exp]	37.94	0.8465
AT3G54230		SUA	suppressor of abi3-5 (.1.2)		Potri.017G138401 [exp]	40.07	0.8728

Compare expression of checked genes

Potri.019G042201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.