Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16730 105 / 5e-27 AtTPS02 terpene synthase 02 (.1) AT4G16740 94 / 4e-23 ATTPS03 terpene synthase 03 (.1.2) AT1G70080 93 / 2e-22 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G61680 93 / 2e-22 ATTPS14 terpene synthase 14 (.1.2) AT2G24210 87 / 2e-20 AtTPS10 terpene synthase 10 (.1) AT4G15870 85 / 1e-19 ATTS1 terpene synthase 1 (.1) AT5G23960 84 / 2e-19 ATTPS21 terpene synthase 21 (.1.2) AT4G20210 83 / 5e-19 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT4G20200 83 / 7e-19 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G25810 80 / 6e-18 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G022338 [exp] 266 / 2e-87 AT3G25830 483 / 8e-165 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023014 [exp] 251 / 2e-83 AT4G16740 294 / 1e-96 terpene synthase 03 (.1.2) Potri.019G023008 [exp] 251 / 6e-82 AT3G25830 535 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023006 [exp] 248 / 2e-80 AT3G25830 540 / 0.0 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G023000 [exp] 223 / 6e-72 AT4G16740 208 / 8e-63 terpene synthase 03 (.1.2) Potri.019G023018 [exp] 184 / 9e-60 AT4G16740 115 / 2e-30 terpene synthase 03 (.1.2) Potri.001G308300 [exp] 157 / 1e-45 AT3G25830 507 / 4e-174 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.001G308200 [exp] 157 / 1e-45 AT3G25810 499 / 4e-171 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Potri.019G016116 [exp] 119 / 1e-33 AT5G23960 236 / 8e-75 terpene synthase 21 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031590 [exp] 106 / 5e-27 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2) Lus10040043 [exp] 102 / 1e-25 AT5G23960 329 / 7e-106 terpene synthase 21 (.1.2) Lus10001110 [exp] 102 / 1e-25 AT3G25810 362 / 1e-118 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10008614 [exp] 100 / 9e-25 AT5G23960 345 / 1e-112 terpene synthase 21 (.1.2) Lus10042204 [exp] 98 / 3e-24 AT5G23960 347 / 4e-113 terpene synthase 21 (.1.2) Lus10014724 [exp] 97 / 7e-24 AT5G23960 314 / 2e-100 terpene synthase 21 (.1.2) Lus10033643 [exp] 96 / 2e-23 AT4G16730 356 / 2e-115 terpene synthase 02 (.1) Lus10008611 [exp] 95 / 4e-23 AT5G23960 348 / 4e-113 terpene synthase 21 (.1.2) Lus10025922 [exp] 95 / 4e-23 AT3G25810 353 / 3e-114 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10018501 [exp] 93 / 2e-22 AT4G16740 413 / 1e-137 terpene synthase 03 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01397 [poplar] [flax] Terpene_synth Terpene synthase, N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.019G046201.1 pacid=42774342 polypeptide=Potri.019G046201.1.p locus=Potri.019G046201 ID=Potri.019G046201.1.v4.1 annot-version=v4.1 ATGATGCTGGCGAATGCATCGAAACCCTTGGATCAACTTGAGCTAATCAATACCTTGGAAAGACTTGGATTATCTTACCATTTCGTTGATGAAATAAAGA GCACTTTGAAGAGCTTATTTGATGAAAATCATATAGAGAATACAGAGACAGTGCATGATTTGTATGCTATTGCTCTAGAATTTCGACTCTTACGGCAGCG TGGATATCATGTACCTCAAGAGGTTTTCAATCATTTCAAGGATGAACAAGGAAACTTTAGGGCATGGATTCATGACGATTTGAAGGGAATGCTAAACCTG TATGAAGCTTCATACTTCTTGGTAGAAGGTGAGAACATATTAGAAGATGCAAGAGACTTCACCACCAAAAATCTTGAAAACTATGTCAAGAAGTGCAACA CGATATTCAGAGTTGGTGAGCCATGCCTTGGAGCTTCCATTGGCTTGGAGGATGCTAAGATTGGAGGCCCATTGGTTCATCAATTTGTATGA
AA sequence Show only first row Show all	>Potri.019G046201.1 pacid=42774342 polypeptide=Potri.019G046201.1.p locus=Potri.019G046201 ID=Potri.019G046201.1.v4.1 annot-version=v4.1 MMLANASKPLDQLELINTLERLGLSYHFVDEIKSTLKSLFDENHIENTETVHDLYAIALEFRLLRQRGYHVPQEVFNHFKDEQGNFRAWIHDDLKGMLNL YEASYFLVEGENILEDARDFTTKNLENYVKKCNTIFRVGEPCLGASIGLEDAKIGGPLVHQFV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G16730		AtTPS02	terpene synthase 02 (.1)		Potri.019G046201 [exp]	0	1
AT3G25830		ATTPS-CIN	"terpene synthase-like sequenc...		Potri.019G022338 [exp]	3.87	0.9995
					Potri.002G184550 [exp]	4.69	0.9999
AT1G80100		AHP6	histidine phosphotransfer prot...		Potri.003G032400 [exp]	5.74	0.9999
AT3G23560		ALF5	ABERRANT LATERAL ROOT FORMATIO...		Potri.011G117200 [exp]	7.41	0.9999
					Potri.011G073141 [exp]	10.48	0.9999
AT4G29280		LCR22	low-molecular-weight cysteine-...		Potri.001G044800 [exp]	12.00	0.9997
					Potri.003G175100 [exp]	12.92	0.9340
AT3G23550			MATE efflux family protein (.1...		Potri.011G117400 [exp]	13.26	0.9998
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Potri.019G023000 [exp]	15.09	0.9971
AT4G24340			Phosphorylase superfamily prot...		Potri.019G050200 [exp]	15.71	0.9997

Compare expression of checked genes

Potri.019G046201 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.