Potri.019G047420 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G40390 65 / 2e-12 DNAse I-like superfamily protein (.1)
AT1G43760 59 / 4e-10 DNAse I-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G128921 427 / 6e-152 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128880 427 / 6e-152 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128860 427 / 6e-152 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128961 427 / 6e-152 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128941 427 / 6e-152 AT1G43760 148 / 5e-39 DNAse I-like superfamily protein (.1)
Potri.004G128901 427 / 6e-152 AT1G43760 149 / 3e-39 DNAse I-like superfamily protein (.1)
Potri.005G153775 419 / 1e-150 AT1G40390 94 / 1e-21 DNAse I-like superfamily protein (.1)
Potri.019G047975 421 / 1e-149 AT1G43760 157 / 3e-42 DNAse I-like superfamily protein (.1)
Potri.003G046951 386 / 5e-139 AT1G40390 48 / 9e-07 DNAse I-like superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016313 56 / 3e-09 ND /
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0530 DNase_I-like PF03372 Exo_endo_phos Endonuclease/Exonuclease/phosphatase family
Representative CDS sequence
>Potri.019G047420.1 pacid=42774343 polypeptide=Potri.019G047420.1.p locus=Potri.019G047420 ID=Potri.019G047420.1.v4.1 annot-version=v4.1
ATGATTATTGGATGTTGGAATATTAGAGGTTTGAATGATCCTATAAAGCATTCAGAATTGCGTCGGCTCATCCATCAAGAGAGGATAGCTCTTTTTGGTC
TGGTTGAAACTCGAGTTAAAGACAAGAATAAAGATAATGTTACTCAACTTCTTCTGCGTTCTTGGTCCTTCTTGTATAATTATGATTTCTCTTGTCGTGG
GCGTATTTGGGTTTGTTGGAATGCTGATACGGTGAAGGTGGATGTTTTTGGAATGTCAGACCAGGCTATTCATGTTTCTGTCACTATATTAGCTACCAAT
ATCAGTTTCAATACTTCAATTATTTATGGAGACAATAATGCTTCCTTACGTGAGGCATTATGGTCTGATATTGTGAGTCGTAGTGATGGATGGGAGTCAA
CCCCGTGGATTCTTATGGGTGATTTTAATGCTATCCGCAACCAGTCGGACAGGTTAGGAGGGTCTACTACGTGGGCTGGTACTATGGACAGATTGGATAC
ATGTATTCGAGAAGCGAAAGTAGATGATCTTCGGTATTCAGGTATGCATTATACTTGGTCGAACCAATGTCCTGAGAATCTGATTATGCGGAAACTAGAT
AGAGTGCTTGTCAATGAGAAGTAA
AA sequence
>Potri.019G047420.1 pacid=42774343 polypeptide=Potri.019G047420.1.p locus=Potri.019G047420 ID=Potri.019G047420.1.v4.1 annot-version=v4.1
MIIGCWNIRGLNDPIKHSELRRLIHQERIALFGLVETRVKDKNKDNVTQLLLRSWSFLYNYDFSCRGRIWVCWNADTVKVDVFGMSDQAIHVSVTILATN
ISFNTSIIYGDNNASLREALWSDIVSRSDGWESTPWILMGDFNAIRNQSDRLGGSTTWAGTMDRLDTCIREAKVDDLRYSGMHYTWSNQCPENLIMRKLD
RVLVNEK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G40390 DNAse I-like superfamily prote... Potri.019G047420 0 1
AT4G20820 FAD-binding Berberine family p... Potri.001G440700 10.90 0.5519
AT1G65480 FT FLOWERING LOCUS T, PEBP (phosp... Potri.008G077700 82.70 0.4784 Pt-PNFT3.4
AT5G10820 Major facilitator superfamily ... Potri.018G017400 84.89 0.4658
AT2G26450 Plant invertase/pectin methyle... Potri.018G051200 105.50 0.4618
Potri.002G025701 108.44 0.4620
AT5G44265 Bifunctional inhibitor/lipid-t... Potri.007G138400 132.54 0.4462
AT1G01900 SBTI1.1, ATSBT1... subtilase family protein (.1) Potri.002G152025 156.55 0.4394
AT1G43760 DNAse I-like superfamily prote... Potri.005G151275 169.55 0.4358
Potri.010G072501 170.23 0.4358
AT1G62420 Protein of unknown function (D... Potri.011G023301 224.96 0.4390

Potri.019G047420 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.