Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08580 79 / 5e-20 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G091200 [exp] 89 / 2e-24 AT1G08580 66 / 2e-15 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040441 [exp] 97 / 6e-27 AT1G08580 110 / 4e-32 unknown protein Lus10023557 [exp] 81 / 7e-19 AT4G39230 461 / 2e-162 NmrA-like negative transcriptional regulator family protein (.1) Lus10003502 [exp] 64 / 5e-14 AT1G08580 81 / 9e-21 unknown protein Lus10002417 [exp] 49 / 1e-08 AT1G08580 61 / 1e-13 unknown protein Lus10000388 [exp] 45 / 3e-07 AT1G08580 61 / 6e-14 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G049300.1 pacid=42773341 polypeptide=Potri.019G049300.1.p locus=Potri.019G049300 ID=Potri.019G049300.1.v4.1 annot-version=v4.1 ATGGCGAAGTTCAATGTACTGCAGAAGATAAGAAGAGCACAAATAGCCGAGAGCAAAAGAGCAATACACGGAGACCCATTAACTAAAAAGCTTAAGATCA GACCTCAGCCCCACTCCGTCTCTGGAAAGCGCAAGCGCAAGCTCTTAAAAAATTGGCGGCGAGAGCAGAAGGAGGCTGTAGACAAGGGTTTGGTCACTAT GCAAGACGTCGAAATGACTTTTGCGCAAGGTGAGGGCACGTCCAAAGATGTCAAGAGGACACCAGCAAAATTTAACAAGAAGGGCCTGAAGCTTAAGCAA TTGAAGCGCAAAGGTAAGAGCAAAACAAAGCCTAAGCCAGCTGCTGAAATTTCTGTGGATGCCATGGCAGAATGA
AA sequence Show only first row Show all	>Potri.019G049300.1 pacid=42773341 polypeptide=Potri.019G049300.1.p locus=Potri.019G049300 ID=Potri.019G049300.1.v4.1 annot-version=v4.1 MAKFNVLQKIRRAQIAESKRAIHGDPLTKKLKIRPQPHSVSGKRKRKLLKNWRREQKEAVDKGLVTMQDVEMTFAQGEGTSKDVKRTPAKFNKKGLKLKQ LKRKGKSKTKPKPAAEISVDAMAE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G08580			unknown protein		Potri.019G049300 [exp]	0	1
AT4G13850		ATGRP2, GR-RBP2	glycine rich protein 2, glycin...		Potri.017G059000 [exp]	1.41	0.8536
AT1G29250			Alba DNA/RNA-binding protein (...		Potri.006G252000 [exp]	1.41	0.8274
AT5G44200		ATCBP20, CBP20	CAP-binding protein 20 (.1.2)		Potri.007G137400 [exp]	2.64	0.7959
AT2G35605			SWIB/MDM2 domain superfamily p...		Potri.005G078400 [exp]	4.89	0.8068
AT1G57540			unknown protein		Potri.005G002900 [exp]	6.24	0.8195
AT5G65260			RNA-binding (RRM/RBD/RNP motif...		Potri.012G115100 [exp]	8.24	0.7127
AT4G33680		AGD2	ABERRANT GROWTH AND DEATH 2, P...		Potri.009G082100 [exp]	9.16	0.7802
AT1G15220		ATCCMH	cytochrome c biogenesis protei...		Potri.003G052000 [exp]	10.48	0.7814
AT5G09570			Cox19-like CHCH family protein...		Potri.009G078100 [exp]	11.83	0.7632
AT4G30330			Small nuclear ribonucleoprotei...		Potri.006G174000 [exp]	12.72	0.7696

Compare expression of checked genes

Potri.019G049300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.