Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23860 132 / 2e-39 SRZ21, SRZ-21, RSZP21, RSZ21, At-RSZ21 RS-containing zinc finger protein 21 (.1.2.3.4) AT2G24590 126 / 6e-37 RSZ22a, At-RSZ22a RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT4G31580 126 / 1e-36 SRZ22, RSZP22, SRZ-22, RSZ22, At-RSZ22 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) AT3G53500 54 / 1e-08 RSZ32, RS2Z32, At-RS2Z arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) AT2G37340 52 / 2e-08 RSZ33, ATRSZ33, RS2Z33, AT-RS2Z33 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) AT1G02840 48 / 1e-06 ATSRP34, SR1, SR34, At-SR34 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT4G02430 47 / 1e-06 SR34b, At-SR34b Serine/Arginine-Rich Protein Splicing Factor 34b, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT3G10400 46 / 4e-06 U11/U12-31K U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) AT4G13860 39 / 0.0001 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G49430 41 / 0.0002 SRP34A, SR34a, At-SR34a Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G272400 [exp] 136 / 8e-41 AT2G24590 152 / 4e-47 RS-containing zinc finger protein 22a, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.018G009100 [exp] 131 / 9e-39 AT4G31580 174 / 2e-55 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Potri.006G215200 [exp] 52 / 5e-08 AT2G37340 266 / 6e-89 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) Potri.016G081700 [exp] 51 / 6e-08 AT2G37340 268 / 2e-89 arginine/serine-rich zinc knuckle-containing protein 33 (.1.2.3) Potri.010G227500 [exp] 50 / 2e-07 AT3G10400 223 / 7e-73 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Potri.005G024600 [exp] 47 / 2e-06 AT1G09140 258 / 6e-86 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2) Potri.014G129900 [exp] 46 / 5e-06 AT1G02840 272 / 5e-91 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.002G205025 [exp] 44 / 2e-05 AT1G02840 272 / 1e-90 Serine/Arginine-Rich Protein Splicing Factor 34, RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.013G015500 [exp] 44 / 2e-05 AT1G09140 263 / 7e-88 Serine/Arginine-Rich Protein Splicing Factor 30, SERINE-ARGININE PROTEIN 30 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012994 [exp] 147 / 3e-44 AT4G31580 162 / 3e-50 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10030858 [exp] 147 / 5e-44 AT4G31580 166 / 9e-51 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10029171 [exp] 149 / 2e-43 AT4G31580 160 / 5e-47 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10030631 [exp] 143 / 7e-43 AT4G31580 164 / 9e-51 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10026925 [exp] 135 / 9e-41 AT4G31580 184 / 2e-59 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10020123 [exp] 135 / 1e-40 AT4G31580 188 / 2e-61 RS-containing zinc finger protein 22, serine/arginine-rich 22 (.1.2) Lus10038693 [exp] 49 / 3e-07 AT3G10400 244 / 6e-81 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Lus10037960 [exp] 49 / 6e-07 AT3G10400 240 / 2e-79 U11/U12-31K, RNA recognition motif and CCHC-type zinc finger domains containing protein (.1) Lus10003987 [exp] 47 / 2e-06 AT3G53500 255 / 2e-84 arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2) Lus10015039 [exp] 47 / 2e-06 AT3G53500 256 / 8e-85 arginine/serine-rich zinc knuckle-containing protein 32, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1), RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) CL0511 [poplar] [flax] Retroviral_zf PF00098 [poplar] [flax] zf-CCHC Zinc knuckle
Representative CDS sequence Show only first row Show all	>Potri.019G050600.10 pacid=42773401 polypeptide=Potri.019G050600.10.p locus=Potri.019G050600 ID=Potri.019G050600.10.v4.1 annot-version=v4.1 ATGTCTCGCGTTTATGTTGGGAATTTGGATCCGCGCGTCTCCGAGAGGGATCTCGAAGATGAATTCCGGATGTATGGTGTTCTTCGTAGTGTCTGGGTTG CTCGAAGGCCACCAGGATATGCATTTGTTGAGTTTGATGATCGCAGGGATGCTATAGATGCAATTCGCGCATTGGATGGAAAGAATGGCTGGCGTGTGGA GCTTTCCCATAATTCTAAGGGTGGTGGAGGCCGTAGTGGCGATGGACATGGACGTGGTGGAGGTGAGGACTCAAAATGTTATGAGTGTGGTGAACCTGGT CATTTTGCACGAGAGTGTCGCCTGCGCATTGGCTCACGAGGCTTGGGAAGTAGTCGTCGTCGAAGCCCCAGTCCTCGCCGCCGTGGAAGTCCAAGTTATG GGTATGGGCGCAGGAGTTATAGCCCCCGTGAGAGAAGATCTCCAAGACGCCGGAGCCTTTCACCTCGCCGAGGTCGCAGCTATAGCAGGTCCCCTCCATA TCGTCATGGCCGCCGTGATTCACCTTATGCTATTGGCGACTGA
AA sequence Show only first row Show all	>Potri.019G050600.10 pacid=42773401 polypeptide=Potri.019G050600.10.p locus=Potri.019G050600 ID=Potri.019G050600.10.v4.1 annot-version=v4.1 MSRVYVGNLDPRVSERDLEDEFRMYGVLRSVWVARRPPGYAFVEFDDRRDAIDAIRALDGKNGWRVELSHNSKGGGGRSGDGHGRGGGEDSKCYECGEPG HFARECRLRIGSRGLGSSRRRSPSPRRRGSPSYGYGRRSYSPRERRSPRRRSLSPRRGRSYSRSPPYRHGRRDSPYAIGD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G23860		SRZ21, SRZ-21, ...	RS-containing zinc finger prot...		Potri.019G050600 [exp]	0	1
AT4G29660		EMB2752	embryo defective 2752 (.1)		Potri.012G001800 [exp]	1.41	0.9110
AT4G14000			Putative methyltransferase fam...		Potri.001G321100 [exp]	1.73	0.9144
AT4G00530			unknown protein		Potri.014G082800 [exp]	9.48	0.8660
AT3G23760			unknown protein		Potri.001G068800 [exp]	9.59	0.8780
AT4G22140		EBS	EARLY BOLTING IN SHORT DAYS, P...		Potri.002G226000 [exp]	11.22	0.8679
AT1G08125			S-adenosyl-L-methionine-depend...		Potri.009G006800 [exp]	12.12	0.8457
AT5G53530		VPS26A	vacuolar protein sorting 26A (...		Potri.009G021200 [exp]	14.89	0.8377
AT5G52380			VASCULAR-RELATED NAC-DOMAIN 6 ...		Potri.012G141700 [exp]	17.14	0.8327
AT1G12910		LWD1, ATAN11	LIGHT-REGULATED WD 1, ANTHOCYA...		Potri.002G220500 [exp]	18.54	0.8323
AT2G32650			RmlC-like cupins superfamily p...		Potri.014G156900 [exp]	18.65	0.8910

Compare expression of checked genes

Potri.019G050600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.