Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G35670 105 / 4e-28 CPK11, ATCDPK2, ATCPK11 calcium-dependent protein kinase 2 (.1) AT4G09570 105 / 8e-28 CPK4, ATCPK4 calcium-dependent protein kinase 4 (.1) AT5G23580 104 / 1e-27 ATCDPK9, CPK12, CDPK9, ATCPK12 CALCIUM-DEPENDENT PROTEIN KINASE 12, ARABIDOPSIS THALIANA CALMODULIN-LIKE DOMAIN PROTEIN KINASE 9, calmodulin-like domain protein kinase 9 (.1) AT3G10660 92 / 3e-23 ATCPK2, CPK2 calmodulin-domain protein kinase cdpk isoform 2 (.1) AT2G38910 92 / 6e-23 CPK20 calcium-dependent protein kinase 20 (.1) AT5G04870 88 / 1e-21 AK1, ATCPK1, CPK1 calcium dependent protein kinase 1 (.1) AT4G38230 83 / 2e-20 CPK26, ATCPK26 ARABIDOPSIS THALIANA CALCIUM-DEPENDENT PROTEIN KINASE 26, calcium-dependent protein kinase 26 (.1.2.3) AT2G17290 83 / 5e-20 ATCPK6, ATCDPK3, CPK6 calcium dependent protein kinase 6, ARABIDOPSIS THALIANA CALCIUM-DEPENDENT PROTEIN KINASE 6, ARABIDOPSIS THALIANA CALMODULIN-DOMAIN PROTEIN KINASE 3, Calcium-dependent protein kinase family protein (.1) AT4G23650 83 / 7e-20 CDPK6, CPK3 Calcium dependent protein kinase 3, calcium-dependent protein kinase 6 (.1) AT4G35310 83 / 8e-20 CPK5, ATCPK5 calmodulin-domain protein kinase 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.T012800 [exp] 111 / 3e-30 AT1G35670 795 / 0.0 calcium-dependent protein kinase 2 (.1) Potri.013G112500 [exp] 110 / 1e-29 AT1G35670 815 / 0.0 calcium-dependent protein kinase 2 (.1) Potri.019G083200 [exp] 108 / 7e-29 AT4G09570 835 / 0.0 calcium-dependent protein kinase 4 (.1) Potri.006G200600 [exp] 94 / 6e-24 AT5G04870 842 / 0.0 calcium dependent protein kinase 1 (.1) Potri.016G066700 [exp] 94 / 6e-24 AT3G10660 834 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Potri.010G244800 [exp] 93 / 2e-23 AT5G04870 899 / 0.0 calcium dependent protein kinase 1 (.1) Potri.008G014700 [exp] 92 / 3e-23 AT5G04870 922 / 0.0 calcium dependent protein kinase 1 (.1) Potri.004G207300 [exp] 88 / 9e-22 AT2G17290 969 / 0.0 calcium dependent protein kinase 6, ARABIDOPSIS THALIANA CALCIUM-DEPENDENT PROTEIN KINASE 6, ARABIDOPSIS THALIANA CALMODULIN-DOMAIN PROTEIN KINASE 3, Calcium-dependent protein kinase family protein (.1) Potri.016G065700 [exp] 88 / 9e-22 AT2G38910 892 / 0.0 calcium-dependent protein kinase 20 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029547 [exp] 107 / 1e-28 AT1G35670 790 / 0.0 calcium-dependent protein kinase 2 (.1) Lus10039623 [exp] 107 / 1e-28 AT1G35670 793 / 0.0 calcium-dependent protein kinase 2 (.1) Lus10009427 [exp] 102 / 1e-26 AT4G09570 792 / 0.0 calcium-dependent protein kinase 4 (.1) Lus10017911 [exp] 97 / 9e-25 AT1G35670 793 / 0.0 calcium-dependent protein kinase 2 (.1) Lus10014820 [exp] 97 / 1e-24 AT1G35670 777 / 0.0 calcium-dependent protein kinase 2 (.1) Lus10021248 [exp] 95 / 4e-24 AT3G10660 809 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Lus10013603 [exp] 95 / 4e-24 AT3G10660 803 / 0.0 calmodulin-domain protein kinase cdpk isoform 2 (.1) Lus10015992 [exp] 93 / 2e-23 AT2G38910 880 / 0.0 calcium-dependent protein kinase 20 (.1) Lus10029358 [exp] 92 / 2e-23 AT5G04870 672 / 0.0 calcium dependent protein kinase 1 (.1) Lus10012285 [exp] 91 / 2e-22 AT2G38910 884 / 0.0 calcium-dependent protein kinase 20 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G050950.1 pacid=42773540 polypeptide=Potri.019G050950.1.p locus=Potri.019G050950 ID=Potri.019G050950.1.v4.1 annot-version=v4.1 ATGGACATCTTAGCCCCTTGTTGGTATTTCAGATTCTTAGGCTTAATTAAGTTCCAGTACAGTGCCTATGTGATCTTTTGTGCAGGCCACCCATGGATCG TGGATGACAGGATTTCCCTAGATAAACCTCTTGATTCTGCTATTTTATCGCACCTGAAGCAGTTCTCTGAAACGAACAAGCTTAAGAAGATGGATTTGCA TGTCATAGCAGAGAGGCTTTCTGAAGAAGAGATGGGTGGTTGGAAAGGCTTGTTCAAAATGATAGACACAGACAACAGTGAAACAATAATTTTGATGAAT TAA
AA sequence Show only first row Show all	>Potri.019G050950.1 pacid=42773540 polypeptide=Potri.019G050950.1.p locus=Potri.019G050950 ID=Potri.019G050950.1.v4.1 annot-version=v4.1 MDILAPCWYFRFLGLIKFQYSAYVIFCAGHPWIVDDRISLDKPLDSAILSHLKQFSETNKLKKMDLHVIAERLSEEEMGGWKGLFKMIDTDNSETIILMN

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G35670		CPK11, ATCDPK2,...	calcium-dependent protein kina...		Potri.019G050950 [exp]	0	1
AT5G16715		EMB2247	embryo defective 2247, ATP bin...		Potri.004G090732 [exp]	1.00	0.9639
AT4G27680			P-loop containing nucleoside t...		Potri.012G027101 [exp]	2.44	0.9237
AT4G27680			P-loop containing nucleoside t...		Potri.012G017760 [exp]	3.46	0.9179
AT4G27680			P-loop containing nucleoside t...		Potri.012G027000 [exp]	4.00	0.9102
AT2G06990		HEN2	hua enhancer 2, RNA helicase, ...		Potri.018G146001 [exp]	5.47	0.8876
AT1G77230			Tetratricopeptide repeat (TPR)...		Potri.005G184001 [exp]	6.00	0.8740
					Potri.008G043250 [exp]	8.77	0.8751
AT1G27410			DNA repair metallo-beta-lactam...		Potri.013G121201 [exp]	9.16	0.8530
AT2G18220			Noc2p family (.1)		Potri.003G213450 [exp]	9.79	0.8861
					Potri.019G131050 [exp]	10.09	0.8583

Compare expression of checked genes

Potri.019G050950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.