Potri.019G051850 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30390 110 / 1e-32 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020378 125 / 8e-39 AT4G30390 115 / 4e-35 unknown protein
Lus10009554 56 / 3e-10 AT1G65090 126 / 9e-34 unknown protein
PFAM info
Representative CDS sequence
>Potri.019G051850.2 pacid=42773181 polypeptide=Potri.019G051850.2.p locus=Potri.019G051850 ID=Potri.019G051850.2.v4.1 annot-version=v4.1
ATGAGAGAAGATTGGATGAGAACCACACCGCCATCGTTACTTTCCCTAACAATTGACACAGCTGTCCTTCACCTCTCAAACTTTTCTGATCTCTCTTCCA
TACCTGATCACATTATCCTCGATCTCTTCCTGAGAACACTGAAAGCTGGAAAACTGACTGAGAAAGTTCTGAAATTGTTTGTGGCGACAGGAAATGATGA
AGTCCTTGCATTCATCCAGGCATTGAACATCCAACATGTCATAACCCCTGTCCTACCTACTAGTGAGTTGTATTTGAAATTTTTTCATCCTATCCTTCCA
GATGTTTTGAGCTGGATTTTGAAGCTTTTCTCTTACTTTTTGATTGTCTATTGA
AA sequence
>Potri.019G051850.2 pacid=42773181 polypeptide=Potri.019G051850.2.p locus=Potri.019G051850 ID=Potri.019G051850.2.v4.1 annot-version=v4.1
MREDWMRTTPPSLLSLTIDTAVLHLSNFSDLSSIPDHIILDLFLRTLKAGKLTEKVLKLFVATGNDEVLAFIQALNIQHVITPVLPTSELYLKFFHPILP
DVLSWILKLFSYFLIVY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G30390 unknown protein Potri.019G051850 0 1
Potri.010G224650 3.87 0.7262
AT5G55390 EDM2 ENHANCED DOWNY MILDEW 2 (.1.2) Potri.014G163301 8.71 0.6849
AT2G18950 ATHPT, VTE2, TP... VITAMIN E 2, homogentisate phy... Potri.018G022000 9.53 0.6579
AT3G03760 AS2 LBD20 LOB domain-containing protein ... Potri.013G064501 9.94 0.6000
AT3G28470 MYB TDF1, ATMYB35 DEFECTIVE IN MERISTEM DEVELOPM... Potri.012G072500 10.95 0.5787 Pt-MYB.54,MYB198
AT5G03980 SGNH hydrolase-type esterase s... Potri.005G024933 12.64 0.6095
AT5G53820 Late embryogenesis abundant pr... Potri.004G107700 17.49 0.5656
AT2G35040 AICARFT/IMPCHase bienzyme fami... Potri.008G128301 19.07 0.5436
Potri.018G058450 25.45 0.5655
Potri.004G127001 31.46 0.4807

Potri.019G051850 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.