Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G16490 108 / 2e-30 RIC4 ROP-interactive CRIB motif-containing protein 4 (.1) AT4G28556 46 / 2e-06 RIC7 PAK-box/P21-Rho-binding family protein (.1) AT4G04900 45 / 4e-06 RIC10 ROP-interactive CRIB motif-containing protein 10 (.1) AT1G27380 42 / 1e-05 RIC2 ROP-interactive CRIB motif-containing protein 2 (.1.2) AT2G20430 42 / 5e-05 RIC6 ROP-interactive CRIB motif-containing protein 6 (.1) AT2G33460 41 / 0.0002 RIC1 ROP-interactive CRIB motif-containing protein 1 (.1) AT3G23380 39 / 0.0008 RIC5 ROP-interactive CRIB motif-containing protein 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G086600 [exp] 227 / 4e-77 AT5G16490 109 / 7e-31 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.014G147000 [exp] 137 / 2e-41 AT5G16490 76 / 8e-18 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.002G233400 [exp] 132 / 2e-39 AT5G16490 89 / 1e-22 ROP-interactive CRIB motif-containing protein 4 (.1) Potri.010G069500 [exp] 46 / 3e-06 AT4G28556 99 / 1e-24 PAK-box/P21-Rho-binding family protein (.1) Potri.011G025300 [exp] 42 / 3e-05 AT4G04900 89 / 5e-23 ROP-interactive CRIB motif-containing protein 10 (.1) Potri.005G227500 [exp] 43 / 4e-05 AT4G28556 106 / 5e-28 PAK-box/P21-Rho-binding family protein (.1) Potri.004G020650 [exp] 41 / 9e-05 AT4G04900 73 / 1e-16 ROP-interactive CRIB motif-containing protein 10 (.1) Potri.002G035500 [exp] 42 / 0.0001 AT2G20430 105 / 1e-27 ROP-interactive CRIB motif-containing protein 6 (.1) Potri.008G168900 [exp] 40 / 0.0005 AT2G33460 101 / 4e-26 ROP-interactive CRIB motif-containing protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10041106 [exp] 67 / 8e-14 AT5G16490 61 / 2e-11 ROP-interactive CRIB motif-containing protein 4 (.1) Lus10036433 [exp] 54 / 5e-09 AT5G16490 64 / 1e-12 ROP-interactive CRIB motif-containing protein 4 (.1) Lus10021974 [exp] 44 / 7e-06 AT2G33460 51 / 4e-08 ROP-interactive CRIB motif-containing protein 1 (.1) Lus10041267 [exp] 42 / 6e-05 AT2G33460 55 / 5e-09 ROP-interactive CRIB motif-containing protein 1 (.1) Lus10008243 [exp] 41 / 0.0001 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1) Lus10003625 [exp] 41 / 0.0001 AT4G28556 94 / 3e-24 PAK-box/P21-Rho-binding family protein (.1) Lus10018362 [exp] 39 / 0.0004 AT4G04900 94 / 2e-24 ROP-interactive CRIB motif-containing protein 10 (.1) Lus10007648 [exp] 39 / 0.0006 AT4G04900 88 / 2e-22 ROP-interactive CRIB motif-containing protein 10 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00786 [poplar] [flax] PBD P21-Rho-binding domain
Representative CDS sequence Show only first row Show all	>Potri.019G053300.1 pacid=42774638 polypeptide=Potri.019G053300.1.p locus=Potri.019G053300 ID=Potri.019G053300.1.v4.1 annot-version=v4.1 ATGAGAGACAGAATGGAAAGGCTTGTTCTTCTTCCCTTCTCCATTGGTTGCGTCTCTGAGTCAAGTGTGGCCATAGGCGTGCACCAAACTAAAAGAGCAA AGACAGACACAAACTTATCTGCATCAAGAACACAAGAAGAAGACGAGGAAAGCTCATCAAGCACAGAAAGTACGAAAAATTCGTTGAAGTTGCTTGCTCT TTCAAAGCCTAACGTATCCACTGGGTTTAATAAGCTAGTCAAGGGTTTGAAGACCTTTCCTCAGTTATTTGCGTACAAAGAAGAGATGGAAGAATTGGAA GTGGAAATGGAAATTGGGCTGCCAACAAATGTTAAGCATGTGACACACATAGGGTGGGATGACTCACCAAATACTAACCCCGTTCAGGGCTGGGACAACC TCATTTCCACCGATTTACTTTCCCTTCAATCTGCAACTTCAAGGCAGTTCGAGCTTGCCATAGCAGGACAGGCTAATTCACCTCTTGTTAGGGCTTCCTC GGCTTAA
AA sequence Show only first row Show all	>Potri.019G053300.1 pacid=42774638 polypeptide=Potri.019G053300.1.p locus=Potri.019G053300 ID=Potri.019G053300.1.v4.1 annot-version=v4.1 MRDRMERLVLLPFSIGCVSESSVAIGVHQTKRAKTDTNLSASRTQEEDEESSSSTESTKNSLKLLALSKPNVSTGFNKLVKGLKTFPQLFAYKEEMEELE VEMEIGLPTNVKHVTHIGWDDSPNTNPVQGWDNLISTDLLSLQSATSRQFELAIAGQANSPLVRASSA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G16490		RIC4	ROP-interactive CRIB motif-con...		Potri.019G053300 [exp]	0	1
AT5G01430			Got1/Sft2-like vescicle transp...		Potri.007G124400 [exp]	1.00	0.9490
AT4G00755			F-box family protein (.1.2)		Potri.014G076300 [exp]	1.41	0.9024
AT3G19450		CAD-C, ATCAD4	CINNAMYL ALCOHOL DEHYDROGENASE...		Potri.009G095800 [exp]	2.44	0.8665	CAD,Pt-CAD4.1
AT3G02600		ATLPP3, LPP3	lipid phosphate phosphatase 3 ...		Potri.008G124900 [exp]	4.89	0.8372
AT5G43150			unknown protein		Potri.008G152200 [exp]	6.63	0.8760
AT3G59390			unknown protein		Potri.019G051300 [exp]	6.63	0.8395
AT3G52790			peptidoglycan-binding LysM dom...		Potri.008G030200 [exp]	7.14	0.8807
AT5G50870		UBC27	ubiquitin-conjugating enzyme 2...		Potri.015G103400 [exp]	9.48	0.8455
AT5G03300		ADK2	adenosine kinase 2 (.1)		Potri.008G038100 [exp]	16.73	0.8659
AT3G15050		IQD10	IQ-domain 10 (.1)		Potri.001G375700 [exp]	18.54	0.8658

Compare expression of checked genes

Potri.019G053300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.