Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	PtrcTrxf
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G02730 204 / 1e-67 TRXF1, ATF1 thioredoxin F-type 1 (.1) AT5G16400 199 / 3e-65 TRXF2, ATF2 thioredoxin F2 (.1) AT3G51030 77 / 2e-18 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT5G39950 75 / 3e-17 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT1G45145 72 / 1e-16 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G42980 71 / 3e-16 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G19730 68 / 6e-15 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT4G26160 67 / 1e-13 ACHT1 atypical CYS HIS rich thioredoxin 1 (.1) AT1G59730 65 / 1e-13 ATH7 thioredoxin H-type 7 (.1) AT3G08710 62 / 2e-12 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G018000 [exp] 82 / 2e-20 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 75 / 1e-17 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 73 / 6e-17 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.008G194100 [exp] 71 / 7e-16 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.017G076700 [exp] 69 / 3e-15 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.006G110100 [exp] 65 / 1e-13 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.015G036000 [exp] 66 / 5e-13 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.018G066500 [exp] 65 / 6e-13 AT4G29670 253 / 3e-85 atypical CYS HIS rich thioredoxin 2 (.1.2) Potri.012G045000 [exp] 65 / 1e-12 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026999 [exp] 210 / 1e-69 AT3G02730 211 / 1e-70 thioredoxin F-type 1 (.1) Lus10020199 [exp] 207 / 8e-69 AT3G02730 207 / 6e-69 thioredoxin F-type 1 (.1) Lus10005258 [exp] 82 / 6e-20 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10030666 [exp] 81 / 2e-19 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10024293 [exp] 77 / 2e-18 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 74 / 3e-17 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 74 / 4e-17 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10022727 [exp] 72 / 5e-16 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 72 / 5e-16 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10028349 [exp] 71 / 6e-16 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00085 [poplar] [flax] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Potri.019G054800.1 pacid=42774595 polypeptide=Potri.019G054800.1.p locus=Potri.019G054800 ID=Potri.019G054800.1.v4.1 annot-version=v4.1 ATGGCTTCGATCCAGTTCTCACTGTCTCCTACTTCCTCCATCCGCTCCTCACCATCCTTTGCCGGTTCTCCTGCAAACCCCATCACGCCCCAATACTCCT CTACCCCCACAAAGGATCTCTCCTCCTACTGCAAGCTATCGTCAAGGCAAAAGAATGTGATCAAGAGGAATGGCAGCAGAAACCTGGTTTCTACAGTGAG GTCGAGCTTGGACACGGCGGGTCCCACTTCCGCTGTTGGACAGGTCACTGAGGTCACCAAGGACACCTTCTGGCCCATCGTTAACTCAGCCGGGGATAAG ACTGTCGTCCTCGACATGTACACCCAATGGTGTGGCCCTTGCAAGTTAATAGCTCCAAAGTACAAGGAATTATCCCAGAAGTATGATGATGTTGTGTTCT TAAAACTTGATTGCAACCAAGAAAACAAGCCGTTGGCAAAAGAGCTTGGCATAAAGGTAGTACCGACCTTCAAGATTCTCAAGCAAGGCAAGATCGTAAA GGAAGTCACCGGGGCCAAATTCGATAATTTAGTTATTGCCATTGAGAGTGTCAGATCCGCCAGCTGA
AA sequence Show only first row Show all	>Potri.019G054800.1 pacid=42774595 polypeptide=Potri.019G054800.1.p locus=Potri.019G054800 ID=Potri.019G054800.1.v4.1 annot-version=v4.1 MASIQFSLSPTSSIRSSPSFAGSPANPITPQYSSTPTKDLSSYCKLSSRQKNVIKRNGSRNLVSTVRSSLDTAGPTSAVGQVTEVTKDTFWPIVNSAGDK TVVLDMYTQWCGPCKLIAPKYKELSQKYDDVVFLKLDCNQENKPLAKELGIKVVPTFKILKQGKIVKEVTGAKFDNLVIAIESVRSAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G02730		TRXF1, ATF1	thioredoxin F-type 1 (.1)		Potri.019G054800 [exp]	0	1	PtrcTrxf
AT5G64480			unknown protein		Potri.001G286200 [exp]	1.41	0.9826
AT4G32260		PDE334	PIGMENT DEFECTIVE 334, ATPase,...		Potri.018G026500 [exp]	2.44	0.9809
AT4G32260		PDE334	PIGMENT DEFECTIVE 334, ATPase,...		Potri.006G255600 [exp]	4.47	0.9784
AT5G64840		ABCF5, ATGCN5	ATP-binding cassette F5, gener...		Potri.007G080600 [exp]	4.69	0.9733	GCN2.1
AT5G43750		PnsB5, NDH18	Photosynthetic NDH subcomplex...		Potri.010G078800 [exp]	5.47	0.9791
AT5G58330			lactate/malate dehydrogenase f...		Potri.008G031700 [exp]	5.91	0.9783
AT5G66190		ATLFNR1	ferredoxin-NADP\(+\)-oxidoredu...		Potri.007G057200 [exp]	7.48	0.9758
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Potri.003G046700 [exp]	7.74	0.9652
AT5G03880			Thioredoxin family protein (.1...		Potri.006G213000 [exp]	8.12	0.9758
AT4G37930		SHMT1, STM, SHM...	SERINE HYDROXYMETHYLTRANSFERAS...		Potri.008G002900 [exp]	9.00	0.9740	SHMT2,SHM1.2

Compare expression of checked genes

Potri.019G054800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.