Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65290 196 / 6e-66 MTACP2 mitochondrial acyl carrier protein 2 (.1) AT2G44620 135 / 7e-42 MTACP1, MTACP-1 mitochondrial acyl carrier protein 1 (.1) AT5G47630 87 / 5e-23 MTACP3 mitochondrial acyl carrier protein 3 (.1.2) AT5G36280 64 / 1e-14 unknown protein AT3G05020 63 / 2e-13 ACP1 acyl carrier protein 1 (.1) AT5G27200 57 / 2e-11 ACP5 acyl carrier protein 5 (.1) AT1G54580 52 / 3e-09 ACP2 acyl carrier protein 2 (.1) AT1G54630 51 / 7e-09 ACP3 acyl carrier protein 3 (.1.2) AT4G25050 49 / 3e-08 ACP4 acyl carrier protein 4 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G084500 [exp] 242 / 3e-84 AT1G65290 188 / 5e-63 mitochondrial acyl carrier protein 2 (.1) Potri.014G044000 [exp] 131 / 2e-40 AT2G44620 163 / 2e-53 mitochondrial acyl carrier protein 1 (.1) Potri.002G135600 [exp] 119 / 1e-35 AT2G44620 177 / 1e-58 mitochondrial acyl carrier protein 1 (.1) Potri.006G005700 [exp] 85 / 3e-22 AT5G47630 107 / 5e-31 mitochondrial acyl carrier protein 3 (.1.2) Potri.016G006300 [exp] 84 / 6e-22 AT5G47630 111 / 1e-32 mitochondrial acyl carrier protein 3 (.1.2) Potri.005G044800 [exp] 56 / 1e-10 AT5G27200 146 / 5e-46 acyl carrier protein 5 (.1) Potri.006G217800 [exp] 54 / 8e-10 AT1G54630 94 / 2e-25 acyl carrier protein 3 (.1.2) Potri.012G105300 [exp] 50 / 1e-08 AT4G25050 107 / 8e-31 acyl carrier protein 4 (.1.2) Potri.013G031300 [exp] 49 / 2e-08 AT3G05020 142 / 1e-44 acyl carrier protein 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020221 [exp] 211 / 4e-72 AT1G65290 183 / 4e-61 mitochondrial acyl carrier protein 2 (.1) Lus10026849 [exp] 209 / 9e-66 AT1G08450 590 / 0.0 PRIORITY IN SWEET LIFE 1, EMS-MUTAGENIZED BRI1 SUPPRESSOR 2, A. thaliana calreticulin 3, calreticulin 3 (.1.2.3) Lus10019500 [exp] 135 / 7e-42 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10043348 [exp] 135 / 7e-42 AT2G44620 186 / 1e-62 mitochondrial acyl carrier protein 1 (.1) Lus10039077 [exp] 81 / 2e-20 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10000050 [exp] 81 / 2e-20 AT5G47630 119 / 1e-35 mitochondrial acyl carrier protein 3 (.1.2) Lus10038782 [exp] 80 / 4e-20 AT5G47630 112 / 6e-33 mitochondrial acyl carrier protein 3 (.1.2) Lus10037910 [exp] 56 / 1e-10 AT4G25050 130 / 4e-40 acyl carrier protein 4 (.1.2) Lus10037908 [exp] 56 / 1e-10 AT4G25050 132 / 8e-41 acyl carrier protein 4 (.1.2) Lus10038636 [exp] 55 / 3e-10 AT4G25050 134 / 3e-41 acyl carrier protein 4 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0314 [poplar] [flax] PP-binding PF00550 [poplar] [flax] PP-binding Phosphopantetheine attachment site
Representative CDS sequence Show only first row Show all	>Potri.019G055300.1 pacid=42774076 polypeptide=Potri.019G055300.1.p locus=Potri.019G055300 ID=Potri.019G055300.1.v4.1 annot-version=v4.1 ATGGCGGCGAGAGGAGCTTTGCTAAAGTACCTGAGAGTGAAGGTACAGGCCATGCCTACCACGCGAAACCCGAACAACAACGGCCTCGTCGGTCTCTCCT TCAATTCCATACGCCGCCGTTTCTCCGAGGAAGTTAGAGGCACCTTCCTTGACAAGTCTGAGGTCACCGATCGAGTCGTCAATGTTGTCAAGAACTTCCA GAAAGTCGATCCTTCCAAGGTTACACCAGATGCCCATTTCCAGAATGATCTTGGGTTAGATAGTCTAGACAGTGTGGAGATTGTGATGGCCCTCGAAGAA GAGTTTCAGTTTGAGATCCCAGATAATGAAGCAGACAAGATCAATTCCATCAGTCTTGCCATTGACTTCATATCTTCACACCCTCAAGCGAAGTAG
AA sequence Show only first row Show all	>Potri.019G055300.1 pacid=42774076 polypeptide=Potri.019G055300.1.p locus=Potri.019G055300 ID=Potri.019G055300.1.v4.1 annot-version=v4.1 MAARGALLKYLRVKVQAMPTTRNPNNNGLVGLSFNSIRRRFSEEVRGTFLDKSEVTDRVVNVVKNFQKVDPSKVTPDAHFQNDLGLDSLDSVEIVMALEE EFQFEIPDNEADKINSISLAIDFISSHPQAK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G65290		MTACP2	mitochondrial acyl carrier pro...		Potri.019G055300 [exp]	0	1
AT2G46230			PIN domain-like family protein...		Potri.014G092600 [exp]	1.41	0.8268
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Potri.007G070000 [exp]	1.73	0.8375
AT5G57020		ATNMT1, NMT1	ARABIDOPSIS THALIANA MYRISTOYL...		Potri.018G066200 [exp]	6.48	0.8253	NMT1.5
AT1G10840		TIF3H1	translation initiation factor ...		Potri.014G147100 [exp]	20.39	0.8063	TIF3.5
AT4G28510		ATPHB1	prohibitin 1 (.1)		Potri.007G134700 [exp]	21.07	0.8197	PHB1.1
AT3G07140			GPI transamidase component Gpi...		Potri.014G190600 [exp]	21.49	0.7583
AT5G09570			Cox19-like CHCH family protein...		Potri.001G282900 [exp]	25.82	0.7808
AT4G16720			Ribosomal protein L23/L15e fam...		Potri.003G078700 [exp]	30.21	0.8000	Pt-RPL15.4
AT3G07910			unknown protein		Potri.003G197801 [exp]	32.12	0.8099
AT1G67620			Lojap-related protein (.1)		Potri.008G105700 [exp]	35.74	0.7388

Compare expression of checked genes

Potri.019G055300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.