Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RPS26.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56340 133 / 5e-41 Ribosomal protein S26e family protein (.1) AT2G40590 131 / 2e-40 Ribosomal protein S26e family protein (.1) AT2G40510 131 / 2e-40 Ribosomal protein S26e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G093700 [exp] 153 / 5e-49 AT3G56340 130 / 3e-40 Ribosomal protein S26e family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030533 [exp] 145 / 6e-46 AT2G40510 185 / 1e-61 Ribosomal protein S26e family protein (.1) Lus10034223 [exp] 143 / 6e-45 AT2G40510 182 / 2e-60 Ribosomal protein S26e family protein (.1) Lus10029042 [exp] 143 / 6e-45 AT2G40510 182 / 2e-60 Ribosomal protein S26e family protein (.1) Lus10012883 [exp] 150 / 9e-45 AT3G10920 356 / 1e-123 MATERNAL EFFECT EMBRYO ARREST 33, ARABIDOPSIS MANGANESE SUPEROXIDE DISMUTASE 1, manganese superoxide dismutase 1 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01283 [poplar] [flax] Ribosomal_S26e Ribosomal protein S26e
Representative CDS sequence Show only first row Show all	>Potri.019G057000.1 pacid=42774452 polypeptide=Potri.019G057000.1.p locus=Potri.019G057000 ID=Potri.019G057000.1.v4.1 annot-version=v4.1 ATGACATTCAAGCGAAGGAATGGAGGCCGCAACAAGCACGGCCGTGGACACACCAAGTTCATCCGATGCTCCAACTGCGGCAAATGCTGCCCGAAGGACA AGGCAATTAAGAGGTTTCTCGTGAGGAACATAGTGGAGCAAGCTGCTGTCAGGGATGTTCAAGAATCCTGTGTTTATGATGGGTATGTCTTGCCCAAACT GTACGTCAAGATGCAGTACTGTGTCTCTTGTGCTATTCACTCCCGTGTTGTGAGGGTTCGCTCTCGCTCTGAGCGCAGGAACAGGGAGCCCCCACAGCGT TTCATTAGACGCAGGGATGACATGCCAAAGCCAGGGCAGCCTGGACAACCTGGGCAAGCACCTCGTCCTGCAGGGGGGGCACCTGCTGCTCGTACCTAG
AA sequence Show only first row Show all	>Potri.019G057000.1 pacid=42774452 polypeptide=Potri.019G057000.1.p locus=Potri.019G057000 ID=Potri.019G057000.1.v4.1 annot-version=v4.1 MTFKRRNGGRNKHGRGHTKFIRCSNCGKCCPKDKAIKRFLVRNIVEQAAVRDVQESCVYDGYVLPKLYVKMQYCVSCAIHSRVVRVRSRSERRNREPPQR FIRRRDDMPKPGQPGQPGQAPRPAGGAPAART

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G56340			Ribosomal protein S26e family ...		Potri.019G057000 [exp]	0	1	RPS26.2
AT5G62300			Ribosomal protein S10p/S20e fa...		Potri.012G128300 [exp]	1.00	0.9752	Pt-RPS20.1
AT1G09690			Translation protein SH3-like f...		Potri.003G159500 [exp]	2.44	0.9689	RPL21.1
AT5G23740		RPS11-BETA	ribosomal protein S11-beta (.1...		Potri.002G140400 [exp]	3.31	0.9636	Pt-RPS11.5
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.006G131500 [exp]	3.46	0.9706
AT2G27710			60S acidic ribosomal protein f...		Potri.009G146200 [exp]	3.46	0.9703
AT4G25740			RNA binding Plectin/S10 domain...		Potri.004G073500 [exp]	4.47	0.9698
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.008G171200 [exp]	4.47	0.9645	RPL23.4
AT5G59850			Ribosomal protein S8 family pr...		Potri.003G114800 [exp]	6.32	0.9659	RPS15.1
AT3G02560			Ribosomal protein S7e family p...		Potri.004G099200 [exp]	6.70	0.9697
AT2G19730			Ribosomal L28e protein family ...		Potri.003G045500 [exp]	8.48	0.9648

Compare expression of checked genes

Potri.019G057000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.