Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G40620 55 / 1e-09 bZIP AtbZIP18 Basic-leucine zipper (bZIP) transcription factor family protein (.1) AT1G06850 50 / 5e-08 bZIP ATBZIP52 basic leucine-zipper 52 (.1.2) AT1G43700 45 / 5e-06 bZIP SUE3, AtbZIP51, VIP1 sulphate utilization efficiency 3, VIRE2-interacting protein 1 (.1) AT4G38900 45 / 6e-06 bZIP AtbZIP29 Basic-leucine zipper (bZIP) transcription factor family protein (.1), Basic-leucine zipper (bZIP) transcription factor family protein (.2), Basic-leucine zipper (bZIP) transcription factor family protein (.3) AT2G31370 43 / 3e-05 bZIP AtbZIP59, PosF21 Basic-leucine zipper (bZIP) transcription factor family protein AT1G06070 42 / 5e-05 bZIP AtbZIP69 Basic-leucine zipper (bZIP) transcription factor family protein (.1) AT2G21230 40 / 0.0004 bZIP AtbZIP30 Basic-leucine zipper (bZIP) transcription factor family protein (.1), Basic-leucine zipper (bZIP) transcription factor family protein (.2), Basic-leucine zipper (bZIP) transcription factor family protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G091400 [exp] 66 / 2e-13 AT2G40620 300 / 2e-100 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.013G156900 [exp] 64 / 2e-12 AT2G40620 291 / 5e-96 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.019G130000 [exp] 62 / 7e-12 AT2G40620 289 / 4e-95 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.005G190700 [exp] 50 / 1e-07 AT1G43700 219 / 2e-69 sulphate utilization efficiency 3, VIRE2-interacting protein 1 (.1) Potri.002G069500 [exp] 49 / 3e-07 AT1G43700 238 / 4e-76 sulphate utilization efficiency 3, VIRE2-interacting protein 1 (.1) Potri.009G125400 [exp] 44 / 9e-06 AT4G38900 481 / 1e-164 Basic-leucine zipper (bZIP) transcription factor family protein (.1), Basic-leucine zipper (bZIP) transcription factor family protein (.2), Basic-leucine zipper (bZIP) transcription factor family protein (.3) Potri.004G163800 [exp] 43 / 2e-05 AT4G38900 425 / 1e-142 Basic-leucine zipper (bZIP) transcription factor family protein (.1), Basic-leucine zipper (bZIP) transcription factor family protein (.2), Basic-leucine zipper (bZIP) transcription factor family protein (.3) Potri.007G130800 [exp] 42 / 4e-05 AT1G06070 392 / 9e-135 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Potri.017G027400 [exp] 40 / 0.0002 AT1G06070 471 / 2e-165 Basic-leucine zipper (bZIP) transcription factor family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042211 [exp] 59 / 8e-11 AT2G40620 277 / 4e-91 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10008605 [exp] 57 / 5e-10 AT2G40620 276 / 1e-90 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10009907 [exp] 52 / 2e-08 AT1G06850 270 / 2e-89 basic leucine-zipper 52 (.1.2) Lus10024204 [exp] 51 / 4e-08 AT1G06850 271 / 5e-90 basic leucine-zipper 52 (.1.2) Lus10018061 [exp] 46 / 3e-06 AT4G38900 529 / 0.0 Basic-leucine zipper (bZIP) transcription factor family protein (.1), Basic-leucine zipper (bZIP) transcription factor family protein (.2), Basic-leucine zipper (bZIP) transcription factor family protein (.3) Lus10029773 [exp] 45 / 5e-06 AT1G43700 311 / 6e-105 sulphate utilization efficiency 3, VIRE2-interacting protein 1 (.1) Lus10042802 [exp] 45 / 6e-06 AT1G43700 313 / 1e-105 sulphate utilization efficiency 3, VIRE2-interacting protein 1 (.1) Lus10042057 [exp] 45 / 6e-06 AT4G38900 522 / 0.0 Basic-leucine zipper (bZIP) transcription factor family protein (.1), Basic-leucine zipper (bZIP) transcription factor family protein (.2), Basic-leucine zipper (bZIP) transcription factor family protein (.3) Lus10030531 [exp] 44 / 1e-05 AT2G40620 286 / 4e-93 Basic-leucine zipper (bZIP) transcription factor family protein (.1) Lus10012881 [exp] 43 / 4e-05 AT2G40620 290 / 7e-96 Basic-leucine zipper (bZIP) transcription factor family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G057550.3 pacid=42773966 polypeptide=Potri.019G057550.3.p locus=Potri.019G057550 ID=Potri.019G057550.3.v4.1 annot-version=v4.1 ATGGAACAACAGGCTGAATTACATGACGCTCTGAATGAAGCATTGAAGAAGGAAATAGAGAGACTCAAGTTTGCTACTGGAGAAATTATGGCACCAACAG TAGCTATAATTTGGGGATGCATCATATTCCATATAACCATTCTCACATGCTTTCACCTAAGCATATCGAAGGCCAGTTCATCGTTTAGAAGATGTTTGAG ACCAGAGATTGCTGCTTCCCCTTCTCATGCCTGCCAGAGATGTTGCTACAGGATCCTCTCACATAGTTGCAGGGGCTTGATATCAGCAGCAGAGCTAGAT CTGAATGCCCCCCAATTTCCGCCAGTGAAGAACTTCATTACAGAATCTCTTGAGGATTTATCTATGTTCAATTTCATATATACACTACTGGTCATCGCGA TTCGCGCTCAATTCAAATCCAAATACTGTTTCTAA
AA sequence Show only first row Show all	>Potri.019G057550.3 pacid=42773966 polypeptide=Potri.019G057550.3.p locus=Potri.019G057550 ID=Potri.019G057550.3.v4.1 annot-version=v4.1 MEQQAELHDALNEALKKEIERLKFATGEIMAPTVAIIWGCIIFHITILTCFHLSISKASSSFRRCLRPEIAASPSHACQRCCYRILSHSCRGLISAAELD LNAPQFPPVKNFITESLEDLSMFNFIYTLLVIAIRAQFKSKYCF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G40620	bZIP	AtbZIP18	Basic-leucine zipper (bZIP) tr...		Potri.019G057550 [exp]	0	1
AT1G21690		RFC4, EMB1968	replication factor C 4, embryo...		Potri.002G080100 [exp]	2.00	0.6511
AT5G47760		ATPK5, ATPGLP2	2-phosphoglycolate phosphatase...		Potri.006G003501 [exp]	36.74	0.5828
AT3G48750		CDKA1, CDC2A, C...	cell division control 2 (.1)		Potri.008G008400 [exp]	37.78	0.5455
AT2G38720		MAP65-5	microtubule-associated protein...		Potri.001G032566 [exp]	65.24	0.5149
AT4G19140			unknown protein		Potri.003G103000 [exp]	127.62	0.4900

Compare expression of checked genes

Potri.019G057550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.