Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G10910 155 / 2e-48 RING/U-box superfamily protein (.1) AT5G05280 144 / 4e-44 RING/U-box superfamily protein (.1) AT5G01880 143 / 1e-43 RING/U-box superfamily protein (.1) AT1G49230 121 / 3e-34 RING/U-box superfamily protein (.1) AT1G49220 103 / 4e-27 RING/U-box superfamily protein (.1) AT1G49210 102 / 4e-27 RING/U-box superfamily protein (.1) AT3G18773 99 / 7e-26 RING/U-box superfamily protein (.1) AT1G76410 97 / 3e-25 ATL8 RING/U-box superfamily protein (.1) AT1G49200 96 / 2e-24 RING/U-box superfamily protein (.1) AT1G20823 92 / 2e-23 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G091300 [exp] 307 / 7e-108 AT3G10910 153 / 2e-47 RING/U-box superfamily protein (.1) Potri.016G136200 [exp] 201 / 5e-66 AT3G10910 144 / 8e-44 RING/U-box superfamily protein (.1) Potri.019G130100 [exp] 161 / 1e-50 AT5G05280 129 / 5e-38 RING/U-box superfamily protein (.1) Potri.013G157000 [exp] 147 / 5e-45 AT3G10910 114 / 1e-32 RING/U-box superfamily protein (.1) Potri.001G309600 [exp] 134 / 3e-39 AT1G49230 261 / 6e-89 RING/U-box superfamily protein (.1) Potri.019G010500 [exp] 125 / 1e-35 AT1G49230 260 / 2e-88 RING/U-box superfamily protein (.1) Potri.001G309700 [exp] 114 / 9e-32 AT1G49230 196 / 2e-63 RING/U-box superfamily protein (.1) Potri.001G159300 [exp] 110 / 6e-31 AT5G05280 134 / 3e-40 RING/U-box superfamily protein (.1) Potri.003G075200 [exp] 109 / 2e-30 AT5G05280 137 / 2e-41 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029037 [exp] 174 / 8e-56 AT3G10910 166 / 9e-53 RING/U-box superfamily protein (.1) Lus10006788 [exp] 132 / 3e-38 AT1G49230 214 / 2e-70 RING/U-box superfamily protein (.1) Lus10005814 [exp] 126 / 2e-36 AT1G49230 215 / 1e-70 RING/U-box superfamily protein (.1) Lus10022743 [exp] 124 / 6e-36 AT3G10910 154 / 5e-48 RING/U-box superfamily protein (.1) Lus10005817 [exp] 124 / 5e-35 AT1G49230 207 / 2e-67 RING/U-box superfamily protein (.1) Lus10025146 [exp] 118 / 8e-34 AT3G10910 128 / 8e-38 RING/U-box superfamily protein (.1) Lus10033515 [exp] 120 / 2e-33 AT1G49230 224 / 6e-74 RING/U-box superfamily protein (.1) Lus10006785 [exp] 119 / 2e-33 AT1G49230 197 / 7e-64 RING/U-box superfamily protein (.1) Lus10020859 [exp] 118 / 8e-33 AT1G49230 230 / 3e-76 RING/U-box superfamily protein (.1) Lus10005816 [exp] 115 / 2e-32 AT1G49230 169 / 5e-53 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.019G057700.2 pacid=42774324 polypeptide=Potri.019G057700.2.p locus=Potri.019G057700 ID=Potri.019G057700.2.v4.1 annot-version=v4.1 ATGTTTGCTGTTCATCATCGTCCACACCGGCTACTCCTGGAGACAGAATCAAGCACACAATCTGCAGCAAATGGAAGCAGGACGCGCAACACATACAACA GCGAGGCCAATTTTGATACCAACATGGTGATCATCTTGGCAGCTTTGCTTTGTGCGTTAATTTGTGCCCTTGGACTAAATTCTATAGTACGATGCGCCAT ACGCTGTAGCAGGAGGTTTACTTTCGAGACTCGTGATCAGACTGCAGCACATATGGCAGCAACAGGCCTCAAAAAGAGCGCATTGCGACGAATCCCAGTG ATTATATACGGGGTGGCAGGGATACATTTAATAGCTACAGATTGTGCAATTTGCCTAGGTGAGTTCATAGGTGGTGAGAAAGTACGAGTTTTGCCCAATT GTAACCATGGATTTCATGTTAGGTGCATTGACACATGGTTGGTATCACACTCCTCCTGTCCAACTTGCCGGCAGTCACTACTTGAGCAACCAGCAAGTTC TGATGCCACAGAAATTGAAGTTGGGATTAGACATCCGGGAAATGATGTTCCTATTGCTGGAGATCACGAAGCTGGTTGA
AA sequence Show only first row Show all	>Potri.019G057700.2 pacid=42774324 polypeptide=Potri.019G057700.2.p locus=Potri.019G057700 ID=Potri.019G057700.2.v4.1 annot-version=v4.1 MFAVHHRPHRLLLETESSTQSAANGSRTRNTYNSEANFDTNMVIILAALLCALICALGLNSIVRCAIRCSRRFTFETRDQTAAHMAATGLKKSALRRIPV IIYGVAGIHLIATDCAICLGEFIGGEKVRVLPNCNHGFHVRCIDTWLVSHSSCPTCRQSLLEQPASSDATEIEVGIRHPGNDVPIAGDHEAG

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G10910			RING/U-box superfamily protein...		Potri.019G057700 [exp]	0	1
AT5G14940			Major facilitator superfamily ...		Potri.017G152800 [exp]	1.41	0.8578
AT4G02590	bHLH	bHLH059, UNE12	unfertilized embryo sac 12, ba...		Potri.005G217800 [exp]	3.16	0.8468
AT2G37730			Protein of unknown function (D...		Potri.016G101200 [exp]	4.24	0.8357
AT3G08640			Protein of unknown function (D...		Potri.006G111300 [exp]	4.47	0.7767
AT5G54310		NEV, AGD5	NEVERSHED, ARF-GAP domain 5 (....		Potri.011G044100 [exp]	5.00	0.8140
AT1G20160		ATSBT5.2	Subtilisin-like serine endopep...		Potri.002G018600 [exp]	5.65	0.8255	Pt-SSTP.2
AT5G45030			Trypsin family protein (.1.2)		Potri.012G121700 [exp]	6.32	0.8004
AT2G27990	HD	PNF, BLH8	POUND-FOOLISH, BEL1-like homeo...		Potri.004G213300 [exp]	6.48	0.8098
AT5G06570			alpha/beta-Hydrolases superfam...		Potri.016G065000 [exp]	6.70	0.8000
AT1G71980			Protease-associated (PA) RING/...		Potri.013G111500 [exp]	8.06	0.7893

Compare expression of checked genes

Potri.019G057700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.