Potri.019G059500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40765 44 / 1e-07 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012871 52 / 1e-09 AT5G24550 466 / 1e-157 beta glucosidase 32 (.1)
PFAM info
Representative CDS sequence
>Potri.019G059500.1 pacid=42774039 polypeptide=Potri.019G059500.1.p locus=Potri.019G059500 ID=Potri.019G059500.1.v4.1 annot-version=v4.1
ATGGCAGGAGAAAACGCAATGTTCAAGTTCTTGAGTCCCAGACTCCGCCTCCAATCCACCGATATCCAAACTGCCGCCTTTTGGGGTGTCGCCGCCGGCA
CCACCGCTCTATGGCTTGTCCAGCCATTTGATTGGATTAAAAAGACCTTTTTCGAGAAAGCAAACACTGAAGAGAAGTGA
AA sequence
>Potri.019G059500.1 pacid=42774039 polypeptide=Potri.019G059500.1.p locus=Potri.019G059500 ID=Potri.019G059500.1.v4.1 annot-version=v4.1
MAGENAMFKFLSPRLRLQSTDIQTAAFWGVAAGTTALWLVQPFDWIKKTFFEKANTEEK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G40765 unknown protein Potri.019G059500 0 1
AT1G64520 RPN12A regulatory particle non-ATPase... Potri.001G088200 3.16 0.9216
AT5G05370 Cytochrome b-c1 complex, subun... Potri.019G132000 5.74 0.9147
AT1G13950 EIF5A, ATELF5A-... eukaryotic elongation factor 5... Potri.010G162800 7.48 0.9008
AT3G14290 PAE2 20S proteasome alpha subunit E... Potri.001G162900 8.36 0.9051 Pt-PAE1.1
AT2G18990 TXND9 thioredoxin domain-containing ... Potri.009G092700 9.16 0.9171
AT2G02050 NADH-ubiquinone oxidoreductase... Potri.010G099900 9.59 0.8868
AT2G46540 unknown protein Potri.002G173101 9.94 0.8959
AT3G48680 AtCAL2, GAMMACA... gamma carbonic anhydrase-like ... Potri.012G100400 13.11 0.9064
AT1G45000 AAA-type ATPase family protein... Potri.005G231700 15.68 0.9041 RPT4.1
AT1G09150 pseudouridine synthase and arc... Potri.005G023600 21.44 0.8964

Potri.019G059500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.