Potri.019G061200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G40780 179 / 7e-58 Nucleic acid-binding, OB-fold-like protein (.1.2)
AT2G40910 52 / 5e-08 F-box and associated interaction domains-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10029014 211 / 1e-70 AT2G40780 199 / 4e-66 Nucleic acid-binding, OB-fold-like protein (.1.2)
Lus10034249 209 / 9e-70 AT2G40780 197 / 4e-65 Nucleic acid-binding, OB-fold-like protein (.1.2)
Lus10030510 176 / 5e-57 AT2G40780 155 / 5e-49 Nucleic acid-binding, OB-fold-like protein (.1.2)
Lus10012866 0 / 1 AT2G40780 51 / 3e-15 Nucleic acid-binding, OB-fold-like protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0021 OB PF01176 eIF-1a Translation initiation factor 1A / IF-1
Representative CDS sequence
>Potri.019G061200.1 pacid=42773201 polypeptide=Potri.019G061200.1.p locus=Potri.019G061200 ID=Potri.019G061200.1.v4.1 annot-version=v4.1
ATGAAAGGAGGAAGGAAGAATATGAAGAGAGCAGCAGTAGCAGAGGAACACAATTTAAGTCTTGAAGGTGGGCAAAGCATCATGCAAGTTGTTTCTCTCA
GGGGTTCCAATCTTATTGAGGTAATGGATGCAAGAGGTGGGAAGTCACTAGCTTTGTTTCCGGCTAAATTTCAGAAGAGTATGTGGATAAAAAGAGGAAG
TTTTGTCGTGGTTGATGAAAGTGGCAAGGAAAAGGCTTTGGAGTCAGGCAGCAAAGTGGCATGTATTGTTTCTCAAGTTCTCTTTTATGAACATGTCCGT
GTGCTTCAGAGATCTCCTGAATGGCCAGAGATTTTCAAATCTACAGCTCTGGATGATTCTAGTGGAAGTCTGAACATAACCAATGGCCAACTTGAAGAGA
ATGAGCTTGAATCAAGTGATGATGATGGGCTTCCTCCATTAGAAGCAAATATGAACAGAATCAAGCCACCAGAATGGGAACAATCTGATACAGAGTCCAA
TTCAGGATCAGATACGGATTCTTAA
AA sequence
>Potri.019G061200.1 pacid=42773201 polypeptide=Potri.019G061200.1.p locus=Potri.019G061200 ID=Potri.019G061200.1.v4.1 annot-version=v4.1
MKGGRKNMKRAAVAEEHNLSLEGGQSIMQVVSLRGSNLIEVMDARGGKSLALFPAKFQKSMWIKRGSFVVVDESGKEKALESGSKVACIVSQVLFYEHVR
VLQRSPEWPEIFKSTALDDSSGSLNITNGQLEENELESSDDDGLPPLEANMNRIKPPEWEQSDTESNSGSDTDS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G40780 Nucleic acid-binding, OB-fold-... Potri.019G061200 0 1
AT1G20696 NFD3, NFD03, HM... high mobility group B3 (.1.2.3... Potri.005G101400 2.23 0.9058 HMGB915
AT3G06180 Ribosomal protein L34e superfa... Potri.008G201700 2.64 0.8758
AT3G02468 CPuORF9 conserved peptide upstream ope... Potri.004G106750 3.87 0.8876
AT3G25910 Protein of unknown function (D... Potri.006G154300 4.47 0.8356
AT1G29220 transcriptional regulator fami... Potri.004G058700 4.47 0.8968
AT5G11170 DEAD/DEAH box RNA helicase fam... Potri.018G028600 6.00 0.8770
AT4G08960 phosphotyrosyl phosphatase act... Potri.002G099000 7.74 0.8248
AT1G78230 Outer arm dynein light chain 1... Potri.002G097800 8.06 0.8779
AT1G02090 ATCSN7, COP15, ... FUSCA 5, CONSTITUTIVE PHOTOMOR... Potri.014G047200 8.24 0.7996
AT1G75510 Transcription initiation facto... Potri.005G233800 10.00 0.8827

Potri.019G061200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.