Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G12300 138 / 4e-38 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63400 126 / 5e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12620 124 / 4e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12700 124 / 5e-33 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT1G62680 123 / 6e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63130 123 / 1e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63150 122 / 3e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62910 121 / 4e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12775 120 / 8e-32 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62590 120 / 1e-31 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G021200 [exp] 283 / 4e-93 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G271400 [exp] 280 / 4e-92 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G242500 [exp] 268 / 3e-87 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271200 [exp] 267 / 5e-87 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074500 [exp] 266 / 1e-86 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G257300 [exp] 251 / 1e-80 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074700 [exp] 224 / 5e-71 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242200 [exp] 225 / 8e-71 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G149800 [exp] 181 / 8e-54 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029737 [exp] 132 / 8e-36 AT1G63130 424 / 6e-140 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10042768 [exp] 130 / 6e-35 AT1G12700 418 / 8e-138 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10022861 [exp] 128 / 2e-34 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003427 [exp] 117 / 2e-31 AT1G12700 291 / 8e-92 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10024962 [exp] 117 / 8e-31 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003447 [exp] 117 / 1e-30 AT1G12700 202 / 1e-56 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10008593 [exp] 116 / 3e-30 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014244 [exp] 114 / 2e-29 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014245 [exp] 113 / 4e-29 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003433 [exp] 109 / 7e-28 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.019G062266.1 pacid=42773499 polypeptide=Potri.019G062266.1.p locus=Potri.019G062266 ID=Potri.019G062266.1.v4.1 annot-version=v4.1 ATGATGATGGCGGCTGCAGTGAGACGAGGTTCAGAACCCTTTTTTATTGAGTCCCATTTTCAGCGATGCCAAATGAAAATAACGGGTATGATTCTTCCAT CTCTCCTGTCTAGCAGCCACTCCAACTCCATTTCTTCTTCTAGCAGTAGCAGTAGATATAAACACCAAAATGATGATGCTTCTCCTTCTTTTAGGAACAT TGACGATGCCCTTGCTTCTTTCAACCACATGCTTCACAGGAAACCCCTGCCTTGTATCATCCAATTCACCAAATTATTGTCTGCAATCGTCAAAATGAGA CAGTATTACGATGCTGTGATTTCTCTTTCCAGACCAATGGAATTAGCTGGGCTCTCTCCTAATACTTATACGCTTAATATCTTGATTAACTGCTTCTGCA AGCTGCAACATGTTGATCTCGGCTTCTCTGTCTTGGCCAAAGTCATTAAACTTGGTCTTCAACCCGATGTTGTCCCATTTACCACCTTAATCAATGGGCT CTGTAAAGTGGGTAAATTTTCCCAAGCCGTGGAATTATTTGATGAAACGGTGGAAAGAGGGTGCCGACCTGATTTTCACACATAA
AA sequence Show only first row Show all	>Potri.019G062266.1 pacid=42773499 polypeptide=Potri.019G062266.1.p locus=Potri.019G062266 ID=Potri.019G062266.1.v4.1 annot-version=v4.1 MMMAAAVRRGSEPFFIESHFQRCQMKITGMILPSLLSSSHSNSISSSSSSSRYKHQNDDASPSFRNIDDALASFNHMLHRKPLPCIIQFTKLLSAIVKMR QYYDAVISLSRPMELAGLSPNTYTLNILINCFCKLQHVDLGFSVLAKVIKLGLQPDVVPFTTLINGLCKVGKFSQAVELFDETVERGCRPDFHT

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G12300			Tetratricopeptide repeat (TPR)...		Potri.019G062266 [exp]	0	1
AT1G31280		AGO2	argonaute 2, Argonaute family ...		Potri.015G117401 [exp]	3.46	0.9203
AT5G42120			Concanavalin A-like lectin pro...		Potri.005G189500 [exp]	8.94	0.9127
					Potri.001G255904 [exp]	12.00	0.9314
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Potri.004G128701 [exp]	19.18	0.8531
AT1G69480			EXS (ERD1/XPR1/SYG1) family pr...		Potri.010G165001 [exp]	22.38	0.8139
					Potri.004G163032 [exp]	26.72	0.8463
AT2G30070		ATKUP1, ATKT1P,...	POTASSIUM UPTAKE TRANSPORTER 1...		Potri.008G140800 [exp]	29.73	0.8776
AT4G05320		UBQ10	polyubiquitin 10 (.1.2.3.4.5.6...		Potri.001G263000 [exp]	32.17	0.9046	Pt-UBQ11.1
					Potri.006G160950 [exp]	35.14	0.9074
					Potri.001G284801 [exp]	39.66	0.8346

Compare expression of checked genes

Potri.019G062266 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.