Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G22470 140 / 9e-40 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62930 135 / 7e-38 RPF3 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63400 133 / 4e-37 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63130 133 / 6e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12775 131 / 4e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G62680 129 / 1e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12620 129 / 1e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12300 129 / 2e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G62910 127 / 8e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G64580 124 / 6e-34 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G271400 [exp] 260 / 5e-85 AT1G12700 486 / 3e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G257300 [exp] 256 / 2e-83 AT1G62930 481 / 3e-163 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074700 [exp] 250 / 7e-82 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242500 [exp] 251 / 1e-81 AT1G62930 473 / 1e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.019G021200 [exp] 248 / 1e-80 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.006G242200 [exp] 243 / 2e-78 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G271200 [exp] 240 / 2e-77 AT1G62930 475 / 3e-161 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074500 [exp] 232 / 3e-74 AT1G62930 478 / 1e-162 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G038300 [exp] 193 / 3e-59 AT1G12700 490 / 8e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039310 [exp] 145 / 5e-44 AT3G22470 226 / 6e-70 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10014242 [exp] 142 / 3e-41 AT1G62930 256 / 5e-78 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014245 [exp] 144 / 6e-41 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10022861 [exp] 141 / 4e-40 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014247 [exp] 140 / 2e-39 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10009201 [exp] 133 / 1e-38 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10024962 [exp] 136 / 2e-38 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003433 [exp] 137 / 3e-38 AT1G12700 396 / 2e-129 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014244 [exp] 135 / 8e-38 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10008593 [exp] 131 / 3e-36 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF12854 [poplar] [flax] PPR_1 PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.019G062332.2 pacid=42774129 polypeptide=Potri.019G062332.2.p locus=Potri.019G062332 ID=Potri.019G062332.2.v4.1 annot-version=v4.1 ATGATAACCAAGGGTTGTAAACCTAATGTTTTTAGTTATAACATCTTAATTAATGGATATTGTAAGGCCGAAAGGATAGATGAAGCTAAGCAGCTTTTTA ATGAAATGATTCATCAAGGCTTAACTCCGAACATTGTTAGTTACAATACTCATGGCTTTTGCCAACTAGGCAAGCTCAGGGAAGCACAAGAGCTTAACAA GAATATGCACACTAATGGCAACCTCCTAGATTTATGTACGTACTCAATATTGCTTGATGGCTTTTGCAAACAAGGGTATCTTGGTAAGGCACTCAGAATC TTTAGAGCAATGCAAAGTACTTACATGAAGCCTAATCTGGTGGTGTATAACATCCTGGTTGACGCAATGTGCAAATCCAGGAATCATAAAGCTGCAAGGA AACTGTTTTCAGAACTCTTTGTCCAAGGGTTGCAGCGTGATTTAATCAGATAG
AA sequence Show only first row Show all	>Potri.019G062332.2 pacid=42774129 polypeptide=Potri.019G062332.2.p locus=Potri.019G062332 ID=Potri.019G062332.2.v4.1 annot-version=v4.1 MITKGCKPNVFSYNILINGYCKAERIDEAKQLFNEMIHQGLTPNIVSYNTHGFCQLGKLREAQELNKNMHTNGNLLDLCTYSILLDGFCKQGYLGKALRI FRAMQSTYMKPNLVVYNILVDAMCKSRNHKAARKLFSELFVQGLQRDLIR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G22470			Pentatricopeptide repeat (PPR)...		Potri.019G062332 [exp]	0	1
AT1G64320			myosin heavy chain-related (.1...		Potri.001G094332 [exp]	3.74	0.8478
AT5G42340		PUB15	Plant U-Box 15 (.1)		Potri.003G214100 [exp]	8.12	0.8295
AT1G27650	C3HZnF	ATU2AF35A	U2 snRNP auxiliary factor smal...		Potri.009G149600 [exp]	9.79	0.8157
AT1G55750			BSD domain (BTF2-like transcri...		Potri.005G061432 [exp]	13.96	0.8171
AT5G17910			unknown protein		Potri.019G044500 [exp]	15.65	0.8347
AT1G18800		NRP2	NAP1-related protein 2 (.1)		Potri.004G128701 [exp]	16.49	0.8136
AT3G44880		PAO, LLS1, ACD1	LETHAL LEAF-SPOT 1 HOMOLOG, AC...		Potri.009G004100 [exp]	18.73	0.7951
AT1G17680			tetratricopeptide repeat (TPR)...		Potri.013G128900 [exp]	18.76	0.8032
					Potri.003G027116 [exp]	23.87	0.8070
AT3G26040			HXXXD-type acyl-transferase fa...		Potri.004G017900 [exp]	24.00	0.8375

Compare expression of checked genes

Potri.019G062332 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.