Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G79580 56 / 5e-09 NAC ANAC033, SMB, NST6 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) AT5G62380 55 / 7e-09 NAC ANAC101, VND6 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) AT2G46770 55 / 9e-09 NAC NST1, ANAC043, EMB2301 NAC SECONDARY WALL THICKENING PROMOTING FACTOR1, Arabidopsis NAC domain containing protein 43, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G07680 52 / 1e-07 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT1G32770 51 / 1e-07 NAC NST3, ANAC012, SND1 SECONDARY WALL-ASSOCIATED NAC DOMAIN 1, NAC SECONDARY WALL THICKENING PROMOTING 3, NAC domain containing protein 12 (.1) AT3G61910 49 / 5e-07 NAC NST2, ANAC066 NAC SECONDARY WALL THICKENING PROMOTING FACTOR2, NAC domain protein 66 (.1) AT1G71930 46 / 5e-06 NAC VND7, ANAC030 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) AT1G12260 46 / 6e-06 NAC ANAC007, VND4, EMB2749 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) AT5G64060 46 / 6e-06 NAC ANAC103 NAC domain containing protein 103 (.1) AT1G69490 46 / 6e-06 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G028700 [exp] 82 / 2e-18 AT2G24430 65 / 1e-11 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.015G002900 [exp] 81 / 1e-17 AT1G71930 71 / 2e-13 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1) Potri.016G027900 [exp] 80 / 1e-17 AT2G24430 66 / 8e-12 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.001G220500 [exp] 80 / 2e-17 AT1G77450 66 / 4e-12 NAC domain containing protein 32 (.1) Potri.006G029200 [exp] 70 / 2e-14 AT3G10480 67 / 8e-13 NAC domain containing protein 50 (.1.2.3) Potri.006G231300 [exp] 67 / 6e-13 AT5G62380 61 / 5e-10 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Potri.006G028300 [exp] 66 / 1e-12 AT3G10480 74 / 5e-14 NAC domain containing protein 50 (.1.2.3) Potri.014G163600 [exp] 66 / 2e-12 AT5G62380 58 / 3e-09 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1) Potri.006G028900 [exp] 65 / 3e-12 AT3G10480 71 / 8e-14 NAC domain containing protein 50 (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008200 [exp] 81 / 2e-18 ND 43 / 6e-05 Lus10033676 [exp] 81 / 2e-17 AT3G10480 72 / 4e-13 NAC domain containing protein 50 (.1.2.3) Lus10008240 [exp] 80 / 2e-17 AT1G33060 50 / 1e-06 NAC 014 (.1.2) Lus10004531 [exp] 80 / 3e-17 AT2G24430 50 / 2e-06 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10007204 [exp] 79 / 3e-17 ND 43 / 2e-04 Lus10003334 [exp] 75 / 7e-17 AT1G61110 50 / 1e-07 NAC domain containing protein 25 (.1) Lus10010294 [exp] 77 / 3e-16 AT5G46590 59 / 1e-09 NAC domain containing protein 96 (.1) Lus10033699 [exp] 76 / 6e-16 AT3G04060 49 / 6e-06 NAC domain containing protein 46 (.1) Lus10019638 [exp] 71 / 6e-15 AT1G12260 59 / 4e-10 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10009858 [exp] 71 / 2e-14 AT5G62380 53 / 1e-07 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.019G063000.1 pacid=42773546 polypeptide=Potri.019G063000.1.p locus=Potri.019G063000 ID=Potri.019G063000.1.v4.1 annot-version=v4.1 ATGTCTCTTGCTAATATTGCTGTAGGGTTCCGATTTAACCCTACAGAGGCTGAACTTGCTTGCCATTATCTTTACAACAAAGTCATGGGTCTTCCTCTAT CTTGCCCTTACATTGTTCAAGATTATGATCTATATGGTCATGAGGAGCCTTGGCAGATATGGGAAAATTTTGGAGAATACAATAATACTACTAGTGATGA TGAGGATGATGATGAAGTTGAGGCTGGTCCGTCTCCTCAGGATGATCTTTTCTTTTTCACAAATTTGAGAAAGATAAACCCTGGCATGAAATCCTCCAAA TTTGATCGTGGTGTTGGGTCCAATGGGGGCCGTTGGCATGGTGACGATGTTCATTCATTCCATTCCAAAGGAATTACTTGGAATCGAAGGAGATATTGTT ACAAGAATCCCAATATAGGCACTCCTGATGCTTCCTGGATTATGTTGGAGTATTCCCTCGATGATTCTCTTATGCAGAATGTTCCTCATTATACTGTGCT CTGTCGAATTCGGAAAAAGAGTAACAAGAATTGCAGTAGAAAGAGGAAATCAAGCCAATCTAGCTCTCAGCCTGAGCCTAAACGCCAGTCGAAGAAATTG AACTCGAAATTGAGGACACCTCCGATTAAAGAAAAGAAACTGTTCATGTGA
AA sequence Show only first row Show all	>Potri.019G063000.1 pacid=42773546 polypeptide=Potri.019G063000.1.p locus=Potri.019G063000 ID=Potri.019G063000.1.v4.1 annot-version=v4.1 MSLANIAVGFRFNPTEAELACHYLYNKVMGLPLSCPYIVQDYDLYGHEEPWQIWENFGEYNNTTSDDEDDDEVEAGPSPQDDLFFFTNLRKINPGMKSSK FDRGVGSNGGRWHGDDVHSFHSKGITWNRRRYCYKNPNIGTPDASWIMLEYSLDDSLMQNVPHYTVLCRIRKKSNKNCSRKRKSSQSSSQPEPKRQSKKL NSKLRTPPIKEKKLFM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G79580	NAC	ANAC033, SMB, N...	NAC (No Apical Meristem) domai...		Potri.019G063000 [exp]	0	1
AT1G05910			cell division cycle protein 48...		Potri.017G031150 [exp]	10.77	0.8837
AT5G42920		AtTHO5	THO complex, subunit 5 (.1.2)		Potri.002G125300 [exp]	13.30	0.8868
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Potri.011G127250 [exp]	13.85	0.8878
					Potri.002G161801 [exp]	20.78	0.8775
AT5G13160		PBS1	avrPphB susceptible 1, Protein...		Potri.008G224084 [exp]	24.97	0.8543
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Potri.015G065001 [exp]	25.92	0.8712
AT5G47540			Mo25 family protein (.1)		Potri.019G057100 [exp]	26.22	0.8638
AT5G14950		GMII, ATGMII	golgi alpha-mannosidase II (.1...		Potri.008G117400 [exp]	26.72	0.8324
AT5G04420			Galactose oxidase/kelch repeat...		Potri.008G030901 [exp]	27.65	0.8743
AT4G19610			nucleotide binding;nucleic aci...		Potri.001G081000 [exp]	29.51	0.8666

Compare expression of checked genes

Potri.019G063000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.