Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09720 138 / 8e-40 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G63120 85 / 1e-20 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) AT5G11170 82 / 7e-20 DEAD/DEAH box RNA helicase family protein (.1.2) AT5G11200 82 / 1e-19 DEAD/DEAH box RNA helicase family protein (.1.2.3) AT1G55150 81 / 5e-19 DEA(D/H)-box RNA helicase family protein (.1) AT3G01540 78 / 4e-18 ATDRH1, DRH1 ARABIDOPSIS THALIANA DEAD BOX RNA HELICASE 1, DEAD box RNA helicase 1 (.1.2.3.4) AT5G14610 78 / 5e-18 DEAD box RNA helicase family protein (.1.2) AT3G06480 77 / 8e-18 DEAD box RNA helicase family protein (.1) AT2G33730 74 / 1e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT5G51280 74 / 1e-16 DEAD-box protein abstrakt, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G065300 [exp] 189 / 5e-59 AT3G09720 652 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.012G084600 [exp] 81 / 4e-19 AT5G63120 704 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.003G038300 [exp] 81 / 4e-19 AT1G55150 790 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Potri.018G028600 [exp] 80 / 6e-19 AT5G11170 807 / 0.0 DEAD/DEAH box RNA helicase family protein (.1.2) Potri.006G253100 [exp] 80 / 6e-19 AT5G11170 808 / 0.0 DEAD/DEAH box RNA helicase family protein (.1.2) Potri.015G083000 [exp] 80 / 9e-19 AT5G63120 707 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Potri.013G158000 [exp] 76 / 2e-17 AT1G55150 322 / 3e-104 DEA(D/H)-box RNA helicase family protein (.1) Potri.019G130900 [exp] 76 / 2e-17 AT1G55150 321 / 2e-103 DEA(D/H)-box RNA helicase family protein (.1) Potri.005G047301 [exp] 74 / 7e-17 AT5G51280 520 / 0.0 DEAD-box protein abstrakt, putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013644 [exp] 146 / 9e-43 AT3G09720 614 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10026871 [exp] 147 / 1e-42 AT3G09720 673 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10019484 [exp] 83 / 7e-20 AT5G63120 757 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Lus10043334 [exp] 82 / 2e-19 AT5G63120 752 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2) Lus10014260 [exp] 81 / 2e-19 AT5G11200 794 / 0.0 DEAD/DEAH box RNA helicase family protein (.1.2.3) Lus10002021 [exp] 82 / 3e-19 AT5G11200 768 / 0.0 DEAD/DEAH box RNA helicase family protein (.1.2.3) Lus10002905 [exp] 81 / 4e-19 AT5G11200 423 / 5e-145 DEAD/DEAH box RNA helicase family protein (.1.2.3) Lus10025960 [exp] 81 / 4e-19 AT5G66150 1097 / 0.0 Glycosyl hydrolase family 38 protein (.1) Lus10015627 [exp] 78 / 3e-18 AT1G55150 845 / 0.0 DEA(D/H)-box RNA helicase family protein (.1) Lus10037646 [exp] 78 / 3e-18 AT1G55150 843 / 0.0 DEA(D/H)-box RNA helicase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00271 [poplar] [flax] Helicase_C Helicase conserved C-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.019G064900.1 pacid=42773891 polypeptide=Potri.019G064900.1.p locus=Potri.019G064900 ID=Potri.019G064900.1.v4.1 annot-version=v4.1 ATGTTGATCTTTGTTCAAAGCATTGAGCGAGCAGAAGAACTATATGGAGAGCTGAAATTTGACAGCATTAGAGTTGGTGTTATTCATTCGAATCTATCAC AGGAGCAGCGAGAGAGTGTAATCGATGACTTCAGAGCTGGAAAGACATGGGTTTTGATTGCAACTGATGTGCTTGGTCGGGGTATGGATTTCAAAGGTGT CAAGTGTGTGATTAATTATGATTTCCCAGATTGTGCTGCTTCATACATTCACAGGATTGGTATGTTTCTGAACCTCTGGATACACTCCTATGTCTATATG TGA
AA sequence Show only first row Show all	>Potri.019G064900.1 pacid=42773891 polypeptide=Potri.019G064900.1.p locus=Potri.019G064900 ID=Potri.019G064900.1.v4.1 annot-version=v4.1 MLIFVQSIERAEELYGELKFDSIRVGVIHSNLSQEQRESVIDDFRAGKTWVLIATDVLGRGMDFKGVKCVINYDFPDCAASYIHRIGMFLNLWIHSYVYM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G09720			P-loop containing nucleoside t...		Potri.019G064900 [exp]	0	1
AT5G27640		ATTIF3B1, ATEIF...	EUKARYOTIC TRANSLATION INITIAT...		Potri.006G267500 [exp]	4.00	0.8435	Pt-EIF3.6
AT4G25420		AT2301, GA5, AT...	GA REQUIRING 5, ARABIDOPSIS TH...		Potri.002G151300 [exp]	6.00	0.8401	GA20ox2-1
AT3G07060		EMB1974	embryo defective 1974, NHL dom...		Potri.002G241366 [exp]	6.92	0.8503
AT1G17285			unknown protein		Potri.001G162300 [exp]	6.92	0.8924
AT4G16470			Tetratricopeptide repeat (TPR)...		Potri.016G010100 [exp]	10.09	0.8082
AT1G48380		HYP7, RHL1	HYPOCOTYL 7, root hair initiat...		Potri.004G069400 [exp]	12.00	0.8172
AT1G65450			HXXXD-type acyl-transferase fa...		Potri.002G244600 [exp]	14.31	0.8141
AT2G29690		ATHANSYNAB, ASA...	anthranilate synthase 2 (.1)		Potri.009G044300 [exp]	20.73	0.8132
					Potri.003G204425 [exp]	24.97	0.8073
AT5G64420			DNA polymerase V family (.1)		Potri.009G079900 [exp]	28.72	0.7947

Compare expression of checked genes

Potri.019G064900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.