Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27090 251 / 3e-83 DCD (Development and Cell Death) domain protein (.1) AT5G42050 242 / 3e-79 DCD (Development and Cell Death) domain protein (.1) AT5G61910 91 / 1e-20 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3), DCD (Development and Cell Death) domain protein (.4) AT5G01660 86 / 7e-19 unknown protein AT3G11000 84 / 2e-18 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2) AT2G35140 81 / 2e-17 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3) AT2G32910 76 / 2e-15 DCD (Development and Cell Death) domain protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G069100 [exp] 255 / 7e-85 AT3G27090 426 / 1e-151 DCD (Development and Cell Death) domain protein (.1) Potri.001G330300 [exp] 253 / 4e-84 AT3G27090 424 / 6e-151 DCD (Development and Cell Death) domain protein (.1) Potri.001G088800 [exp] 242 / 9e-79 AT5G42050 289 / 2e-95 DCD (Development and Cell Death) domain protein (.1) Potri.003G141900 [exp] 242 / 1e-78 AT5G42050 285 / 4e-94 DCD (Development and Cell Death) domain protein (.1) Potri.008G074200 [exp] 103 / 4e-25 AT5G01660 488 / 2e-164 unknown protein Potri.016G127600 [exp] 100 / 1e-23 AT5G01660 628 / 0.0 unknown protein Potri.001G136300 [exp] 92 / 2e-21 AT5G61910 180 / 2e-50 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3), DCD (Development and Cell Death) domain protein (.4) Potri.015G122300 [exp] 75 / 3e-15 AT2G35140 211 / 4e-56 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3) Potri.013G029200 [exp] 72 / 4e-14 AT2G32910 187 / 3e-51 DCD (Development and Cell Death) domain protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012533 [exp] 253 / 4e-84 AT3G27090 432 / 5e-154 DCD (Development and Cell Death) domain protein (.1) Lus10041557 [exp] 253 / 6e-84 AT3G27090 428 / 2e-152 DCD (Development and Cell Death) domain protein (.1) Lus10023059 [exp] 249 / 1e-81 AT5G42050 355 / 8e-122 DCD (Development and Cell Death) domain protein (.1) Lus10032412 [exp] 248 / 3e-81 AT5G42050 359 / 1e-123 DCD (Development and Cell Death) domain protein (.1) Lus10012220 [exp] 103 / 2e-25 AT5G01660 224 / 1e-66 unknown protein Lus10018307 [exp] 89 / 7e-20 AT5G01660 276 / 3e-82 unknown protein Lus10017137 [exp] 80 / 1e-16 AT4G19900 693 / 0.0 alpha 1,4-glycosyltransferase family protein (.1) Lus10018316 [exp] 79 / 1e-16 AT2G35140 185 / 3e-48 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3) Lus10032534 [exp] 70 / 1e-13 AT5G61910 169 / 3e-45 DCD (Development and Cell Death) domain protein (.1), DCD (Development and Cell Death) domain protein (.2), DCD (Development and Cell Death) domain protein (.3), DCD (Development and Cell Death) domain protein (.4) Lus10001728 [exp] 63 / 5e-11 AT2G32910 208 / 1e-57 DCD (Development and Cell Death) domain protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10539 [poplar] [flax] Dev_Cell_Death Development and cell death domain
Representative CDS sequence Show only first row Show all	>Potri.019G066100.2 pacid=42774366 polypeptide=Potri.019G066100.2.p locus=Potri.019G066100 ID=Potri.019G066100.2.v4.1 annot-version=v4.1 ATGTCCATAATCAAGAATAATGTCAGTACTGGAAGCTCATTGTGGCAACCCCAGCATGGCATTGCTTCGGCGAATGAGCTACAGGGATGGAGAACAGTTG CATCAAGGCTTGCTTTTGATAGTCAATTGAGAAAGATGGAGGAAAATCAATGCGCAAATGAAGATGGCTGCTATAGGAAATCTCTATTCAGTACTGACAT ATCTGTGAGAAATCCGGCAGCTAAAATGAAACAATACCCTTTTGATAGACAGCAGGAACAGCTTGGTAATTCCAAGTGGTACAGCTACAAGACACTTCCC CCAGCTGAACTGCTGCCAAGAAATGAAGTCATGGGAGGTTACATCTTCGTGTGCAACAACGAGACTATGCAAGAGGACCTCCGGCGCCAGCTCTTCGGTA ATCTCTCACAATCTTTCTGTTCAAGGCTTCCGCACAAGTACAGGGACTCTGTCAGGGCCATAACACCAGGCTTACCCCTTTTCCTTTATAACTACACATG CCATCAGCTGCATGGAGTGTTCCAGGCTGTGAGTTTCGGCGGGTCAAACATAGAACCAACTGCTTGGGAAGACAAGAAGTGTAAAGGGGAATCAAGATTT CCAGCTCAGGTTAGAATTGGATTCAAGAAGAAATGCAAGCCATTGGAAGAGGATGCTTTCAGACCAATTTTATACCACTACGATGGCCCCAAGTTCCGAT TGCAACTCTCTGTGCCAGAGGCGCTTGCATTGCTGGACTTGTTCAATCAGAAGGAGCTTTAA
AA sequence Show only first row Show all	>Potri.019G066100.2 pacid=42774366 polypeptide=Potri.019G066100.2.p locus=Potri.019G066100 ID=Potri.019G066100.2.v4.1 annot-version=v4.1 MSIIKNNVSTGSSLWQPQHGIASANELQGWRTVASRLAFDSQLRKMEENQCANEDGCYRKSLFSTDISVRNPAAKMKQYPFDRQQEQLGNSKWYSYKTLP PAELLPRNEVMGGYIFVCNNETMQEDLRRQLFGNLSQSFCSRLPHKYRDSVRAITPGLPLFLYNYTCHQLHGVFQAVSFGGSNIEPTAWEDKKCKGESRF PAQVRIGFKKKCKPLEEDAFRPILYHYDGPKFRLQLSVPEALALLDLFNQKEL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G27090			DCD (Development and Cell Deat...		Potri.019G066100 [exp]	0	1
AT3G42725			Putative membrane lipoprotein ...		Potri.018G065700 [exp]	3.46	0.9601
AT5G62550			unknown protein		Potri.015G063700 [exp]	5.74	0.9429
AT5G04320			Shugoshin C terminus (.1.2)		Potri.004G216000 [exp]	9.38	0.9507
AT5G58480			O-Glycosyl hydrolases family 1...		Potri.009G076500 [exp]	10.58	0.9252
AT3G16490		IQD26	IQ-domain 26 (.1)		Potri.003G047800 [exp]	11.66	0.8874
AT5G65120			unknown protein		Potri.007G090500 [exp]	12.64	0.9354
AT3G19590		BUB3.1	BUB \(BUDDING UNINHIBITED BY B...		Potri.009G089200 [exp]	14.14	0.9328
AT1G23790			Plant protein of unknown funct...		Potri.010G038600 [exp]	14.28	0.9418
AT5G16250			unknown protein		Potri.013G127900 [exp]	17.83	0.9377
AT3G19184	B3		AP2/B3-like transcriptional fa...		Potri.009G103200 [exp]	19.26	0.9376

Compare expression of checked genes

Potri.019G066100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.