Potri.019G066600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G77350 128 / 3e-39 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018864 139 / 9e-44 AT1G77350 194 / 9e-66 unknown protein
Lus10028559 138 / 4e-43 AT1G77350 194 / 2e-65 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09775 Keratin_assoc Keratinocyte-associated protein 2
Representative CDS sequence
>Potri.019G066600.2 pacid=42773163 polypeptide=Potri.019G066600.2.p locus=Potri.019G066600 ID=Potri.019G066600.2.v4.1 annot-version=v4.1
ATGGCGTCAGGAGCAGGAAGCTCAATGCTATATTCTTTTCTTCTATTCACAGTAATTCTTTCACTTCAAGAGATGTATCGCTCTAAATTGGCTTCCACCG
AGTTATTTACCATCCTTGGCGGATTCATCAGCTCTCTCTTGTTTCTTGTCCTCCTCACTTTAATTGGGAATTTTCAGGAAACATGTGGCATGAAGACTGG
GTGGGGTGCTGTCATCTTAGCAGAAGCTGTTGCTCTAATTGCTGCTGGCACTGTGCATCGTGTTTGCATCACTACATGTTTCTTGTTCTCTGCTGGTCTA
CTGTATGAGGTCAACAAGCTTTCTGGGCTGACACTTTCCAAAAGTGATTCCAAAACAAGAAGGTACTGA
AA sequence
>Potri.019G066600.2 pacid=42773163 polypeptide=Potri.019G066600.2.p locus=Potri.019G066600 ID=Potri.019G066600.2.v4.1 annot-version=v4.1
MASGAGSSMLYSFLLFTVILSLQEMYRSKLASTELFTILGGFISSLLFLVLLTLIGNFQETCGMKTGWGAVILAEAVALIAAGTVHRVCITTCFLFSAGL
LYEVNKLSGLTLSKSDSKTRRY

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G77350 unknown protein Potri.019G066600 0 1
AT5G54750 Transport protein particle (TR... Potri.001G418400 1.41 0.9460
AT4G29735 unknown protein Potri.004G215200 1.41 0.9354
AT1G73177 APC13, BNS anaphase-promoting complex 13,... Potri.011G067800 1.73 0.9336
AT3G15395 unknown protein Potri.001G402000 3.00 0.9194
AT5G07960 unknown protein Potri.015G056300 4.47 0.9172
AT5G45750 AtRABA1c RAB GTPase homolog A1C (.1) Potri.011G070300 4.89 0.9126
AT1G14450 NADH dehydrogenase (ubiquinone... Potri.004G229900 5.00 0.9301
AT1G27970 NTF2B nuclear transport factor 2B (.... Potri.001G057500 5.09 0.8876
AT5G10745 unknown protein Potri.018G014101 5.47 0.8866
AT5G18800 Cox19-like CHCH family protein... Potri.010G026000 5.47 0.9047

Potri.019G066600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.