Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10110 187 / 1e-60 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G18510 76 / 3e-16 EMB2444 embryo defective 2444, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G71800 52 / 9e-08 CSTF64 cleavage stimulating factor 64 (.1) AT5G64200 49 / 5e-07 ATSC35, At-SC35 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) AT1G73530 48 / 7e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G49760 49 / 9e-07 PABP8, PAB8 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) AT2G23350 49 / 1e-06 PABP4, PAB4 poly(A) binding protein 4 (.1) AT4G13860 45 / 1e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G37220 46 / 6e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G52380 46 / 6e-06 CP33, PDE322 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G028300 [exp] 81 / 7e-18 AT2G18510 453 / 4e-160 embryo defective 2444, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G125300 [exp] 78 / 6e-17 AT2G18510 412 / 3e-144 embryo defective 2444, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G061200 [exp] 54 / 2e-08 AT1G71800 354 / 3e-117 cleavage stimulating factor 64 (.1) Potri.006G127200 [exp] 48 / 9e-07 AT2G37220 269 / 5e-90 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.016G068300 [exp] 48 / 1e-06 AT3G52380 264 / 5e-87 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1) Potri.002G124200 [exp] 48 / 2e-06 AT1G49760 822 / 0.0 poly(A) binding protein 8 (.1), poly(A) binding protein 8 (.2) Potri.012G038200 [exp] 47 / 2e-06 AT1G73530 141 / 6e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.003G023800 [exp] 47 / 3e-06 AT5G64200 207 / 4e-66 ARABIDOPSIS THALIANA ORTHOLOG OF HUMAN SPLICING FACTOR SC35, ortholog of human splicing factor SC35 (.1.2) Potri.001G319900 [exp] 45 / 3e-06 AT4G13850 140 / 1e-43 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10007895 [exp] 159 / 5e-50 AT4G10110 153 / 9e-48 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10030350 [exp] 160 / 2e-49 AT4G10110 146 / 2e-44 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10041728 [exp] 80 / 1e-17 AT2G18510 436 / 1e-153 embryo defective 2444, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10024024 [exp] 77 / 4e-17 AT2G18510 275 / 5e-92 embryo defective 2444, RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10017923 [exp] 58 / 5e-10 AT1G71800 306 / 4e-98 cleavage stimulating factor 64 (.1) Lus10014814 [exp] 55 / 6e-09 AT1G71800 350 / 2e-116 cleavage stimulating factor 64 (.1) Lus10028714 [exp] 54 / 2e-08 AT1G71800 308 / 1e-100 cleavage stimulating factor 64 (.1) Lus10016174 [exp] 52 / 7e-08 AT3G52380 275 / 3e-91 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1) Lus10006055 [exp] 49 / 6e-07 AT1G71800 288 / 3e-92 cleavage stimulating factor 64 (.1) Lus10029372 [exp] 49 / 6e-07 AT3G52380 269 / 6e-89 PIGMENT DEFECTIVE 322, chloroplast RNA-binding protein 33 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.019G069000.1 pacid=42774661 polypeptide=Potri.019G069000.1.p locus=Potri.019G069000 ID=Potri.019G069000.1.v4.1 annot-version=v4.1 ATGTCTGGTCCCTCGAGCTGCAGCATTTACATCGGTAATTTAGACGAGAGAGTTAGCGACAGGGTTTTGTATGACATTCTAATTCAAGCAGGCCGTGTCG TGGATTTACACATTCCTCGAGATAGAGAAACTGATAAGCCCAAAGGCTATGCTTTTGCCGAATATGAAACTGAAGAAATTGCCGATTATGCTGTCAAGCT ATTCTCCGGCCTTGTCACTCTCTACAATCGCACCTTGAAATTCGCGATATCTGGACAGGATAAACTTGCGCAAAATAATCTCAATGGGGTTGTGCCTGTT CCCAATTCTTCTAACAGACAAAGGCCATCTCACCCTGTACTGATTAATAATTTAGAAATCCCTAATCATTCCATGAGGTTGTCGGCACCTAGCAGGGTTT CAGCTTACCCTGCAAATGATTCTCTAGCTCCTCCTGGTGTAACAAACCTTTCTAATGGATATGGTTCAAATTCCAATGGCAACAGTAATGATAGTGATCG AAGACTTTTTGGGTCCGCAGTCAATGCCATTAGTCGTTCTAGGTCTCGTTGGTATGATACAAGTAACCCTATGCCATATTCCTACTGA
AA sequence Show only first row Show all	>Potri.019G069000.1 pacid=42774661 polypeptide=Potri.019G069000.1.p locus=Potri.019G069000 ID=Potri.019G069000.1.v4.1 annot-version=v4.1 MSGPSSCSIYIGNLDERVSDRVLYDILIQAGRVVDLHIPRDRETDKPKGYAFAEYETEEIADYAVKLFSGLVTLYNRTLKFAISGQDKLAQNNLNGVVPV PNSSNRQRPSHPVLINNLEIPNHSMRLSAPSRVSAYPANDSLAPPGVTNLSNGYGSNSNGNSNDSDRRLFGSAVNAISRSRSRWYDTSNPMPYSY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G10110			RNA-binding (RRM/RBD/RNP motif...		Potri.019G069000 [exp]	0	1
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Potri.008G203500 [exp]	1.00	0.8415
AT2G47710			Adenine nucleotide alpha hydro...		Potri.002G205275 [exp]	12.64	0.8341
AT3G58030			RING/U-box superfamily protein...		Potri.016G058300 [exp]	13.41	0.8029
AT5G15080			Protein kinase superfamily pro...		Potri.010G033800 [exp]	15.36	0.8370
AT4G15093			catalytic LigB subunit of arom...		Potri.018G136800 [exp]	15.49	0.8064
AT4G10170			SNARE-like superfamily protein...		Potri.013G094900 [exp]	16.24	0.8258
AT3G14470			NB-ARC domain-containing disea...		Potri.018G017900 [exp]	16.24	0.8393	Pt-RGA.54
AT3G14470			NB-ARC domain-containing disea...		Potri.017G143820 [exp]	18.00	0.8278
AT5G64930		HYS1, CPR5	HYPERSENESCENCE 1, CONSTITUTIV...		Potri.005G083600 [exp]	19.59	0.7896
AT4G32300		SD2-5	S-domain-2 5 (.1)		Potri.018G027300 [exp]	22.20	0.8034

Compare expression of checked genes

Potri.019G069000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.