Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20142 147 / 1e-42 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT3G44480 150 / 3e-41 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G36930 150 / 3e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G46450 150 / 5e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44630 148 / 1e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT4G11170 148 / 1e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41750 147 / 4e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G16890 146 / 7e-40 BAL, SNC1 SUPPRESSOR OF NPR1-1, CONSTITUTIVE 1, BALL, disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G51630 146 / 9e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT1G72920 138 / 9e-40 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G069866 [exp] 288 / 4e-99 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G070700 [exp] 312 / 2e-98 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069500 [exp] 308 / 2e-96 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069600 [exp] 300 / 1e-93 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070651 [exp] 293 / 5e-91 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070300 [exp] 284 / 5e-90 AT5G17680 558 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070436 [exp] 259 / 3e-88 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G070393 [exp] 276 / 4e-85 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G068200 [exp] 201 / 5e-59 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042752 [exp] 168 / 1e-52 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10029722 [exp] 182 / 2e-52 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 175 / 1e-50 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10038249 [exp] 169 / 1e-47 AT5G17680 445 / 4e-137 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041060 [exp] 169 / 2e-47 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10011104 [exp] 168 / 3e-47 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10015453 [exp] 155 / 2e-44 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10018616 [exp] 157 / 1e-43 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10030839 [exp] 157 / 1e-43 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10014829 [exp] 157 / 2e-43 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.019G069733.1 pacid=42773630 polypeptide=Potri.019G069733.1.p locus=Potri.019G069733 ID=Potri.019G069733.1.v4.1 annot-version=v4.1 ATGTCGGATATGGCATCGTCTTCTGCAACTGCTCAACAATGGAAGTATGATGTATTCCTCAGTTTTAGAGGCAAGGATACTCGTGACAATTTTACCAGCC ATCTCTATGATGCCTTATGTCATAAACAAATCAAGACTTTCATAGATAATGATCTTGAAAGGGGTGAAGAAATTGAACCTACACTGTTGAGAACAATTGA AGATTCAAGAATTTCAGTAGTGATATTCTCAAAAAACTATGCATCTTCTCCGTGGTGTGTGGATGAACTGGTGAAGATACTAGAATGCAAGAGAACTTGT GGGCAGATTGTTTTACCAGGTTTTTTTTTTTATCATGTAGACCCATCTGATGTAGATGAACAGAGAGGGAGTTTTGGAAATGCATTTGCTAAACTTGAAA GAAATTTTAAATGGAAGATGGACAAGGTTTCAAGCTGGAGAGCTGACTTGACAAATGCGGCCATTATTTCTGGATGGGATTCACAAGTCACTAGGCCTGA GTCCAAACTTGTAAGTGAAATTGCTGAAGCTGTTTTCAACAGTATTTCAAGTCAATATGAAAGCTGCTGTTTTATTACCAATGTAAGAGAGAAATCGGAA GAATGTGGTGGGTTGATTCGCTTGCGAGAGGAATTCCTTTCCAGAGTATTAGAGCAGGAAAATCTCCGTATTGACACTCCACGCTCCACGCATGGGATCC ACTTTAATCAAGGAAAGGATCCGGCACAAAAAAGTCTTAACTGTTCTAGATGA
AA sequence Show only first row Show all	>Potri.019G069733.1 pacid=42773630 polypeptide=Potri.019G069733.1.p locus=Potri.019G069733 ID=Potri.019G069733.1.v4.1 annot-version=v4.1 MSDMASSSATAQQWKYDVFLSFRGKDTRDNFTSHLYDALCHKQIKTFIDNDLERGEEIEPTLLRTIEDSRISVVIFSKNYASSPWCVDELVKILECKRTC GQIVLPGFFFYHVDPSDVDEQRGSFGNAFAKLERNFKWKMDKVSSWRADLTNAAIISGWDSQVTRPESKLVSEIAEAVFNSISSQYESCCFITNVREKSE ECGGLIRLREEFLSRVLEQENLRIDTPRSTHGIHFNQGKDPAQKSLNCSR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.019G069733 [exp]	0	1
AT1G75210			HAD-superfamily hydrolase, sub...		Potri.014G196700 [exp]	1.41	0.9027
AT1G11090			alpha/beta-Hydrolases superfam...		Potri.011G046500 [exp]	2.82	0.8818
AT2G47115			unknown protein		Potri.002G190200 [exp]	5.47	0.8735
AT2G37330		ALS3	aluminum sensitive 3 (.1)		Potri.016G082100 [exp]	5.91	0.8701
AT1G06730			pfkB-like carbohydrate kinase ...		Potri.002G042700 [exp]	6.48	0.8815
AT2G47390			Prolyl oligopeptidase family p...		Potri.002G196000 [exp]	7.48	0.8765
AT2G34470		PSKF109, UREG	urease accessory protein G (.1...		Potri.002G243700 [exp]	12.00	0.8660	Pt-EU3.1
AT3G54960		ATPDI1, ATPDIL1...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.008G040100 [exp]	12.48	0.8705
AT3G04940		ATCYSD1	cysteine synthase D1 (.1)		Potri.005G048132 [exp]	16.24	0.8623
AT2G28930		APK1B	protein kinase 1B (.1.2.3)		Potri.009G031300 [exp]	16.58	0.8450	APK1.1

Compare expression of checked genes

Potri.019G069733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.