Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12010 180 / 3e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41750 176 / 1e-50 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G65850 173 / 7e-50 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G69550 170 / 1e-48 disease resistance protein (TIR-NBS-LRR class) (.1) AT3G44480 168 / 6e-48 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G20142 159 / 7e-48 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G31540 166 / 1e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G04220 166 / 2e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44630 166 / 4e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT1G72920 156 / 4e-47 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G069600 [exp] 406 / 8e-133 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070300 [exp] 389 / 6e-131 AT5G17680 558 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070651 [exp] 397 / 2e-128 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070393 [exp] 367 / 3e-118 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 350 / 4e-113 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069500 [exp] 335 / 8e-107 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070436 [exp] 296 / 7e-104 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G069733 [exp] 288 / 2e-99 AT2G20142 147 / 1e-42 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G068300 [exp] 224 / 8e-68 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10029722 [exp] 209 / 2e-62 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 202 / 2e-61 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 200 / 5e-59 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10042752 [exp] 176 / 2e-56 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10041060 [exp] 189 / 2e-55 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014829 [exp] 186 / 2e-54 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 183 / 2e-53 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10026201 [exp] 183 / 3e-53 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014582 [exp] 166 / 8e-51 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10030839 [exp] 174 / 5e-50 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.019G069866.1 pacid=42773119 polypeptide=Potri.019G069866.1.p locus=Potri.019G069866 ID=Potri.019G069866.1.v4.1 annot-version=v4.1 ATGGCATCTTCATCTGCTGTTGCTCATAAATGGAAGTATGATGTGTTCCTTAGTTTTAGAGGCCAGGATACGCGCAATAATTTTACGAGCCATCTCTATG ATGCTTTGTGTCGTAAGAAAATCAAGACCTTCATTGATAATGGGCTTGAAAGAGGAGAAGAAATTACCCCTGCCCTTCTGAAAACGATTGAAGAATCAAG AATTTCTGTAGTAATTTTCTCCAAGAACTATGCATCTTCTCCGTGGTGTGTGGATGAACTGGTGAAAATACTTGAATGCAAAGAGACTTATGGGCAGATT GTTTTACCGGTCTTCTATCATGTGGACCCATCTGAAGTTGATGAACAGACTGGGAGTTTTGAAAATGCATTTGCCGAACTTGAAAAAAATTTCAAGGGGA AGATGGACAAGTTGCCAAGGTGGAGGGCTGGCTTGACATATGCAGCCAGTATATCTGGATGGGATTCACAGGTTACTAGTCCGGAGTCCAAACTAGTAAG AGAAGTTGTGCAAACTATCTGGAAAAGGTTAAATGATGCATCCCCAAGCAAATTAAGAGGTCTGGTTGGAGTAGATTCACGCATTGAGCAAATCAACAAA TTACTATCTACTGTGCCATCTGAT
AA sequence Show only first row Show all	>Potri.019G069866.1 pacid=42773119 polypeptide=Potri.019G069866.1.p locus=Potri.019G069866 ID=Potri.019G069866.1.v4.1 annot-version=v4.1 MASSSAVAHKWKYDVFLSFRGQDTRNNFTSHLYDALCRKKIKTFIDNGLERGEEITPALLKTIEESRISVVIFSKNYASSPWCVDELVKILECKETYGQI VLPVFYHVDPSEVDEQTGSFENAFAELEKNFKGKMDKLPRWRAGLTYAASISGWDSQVTSPESKLVREVVQTIWKRLNDASPSKLRGLVGVDSRIEQINK LLSTVPSD

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G12010			Disease resistance protein (TI...		Potri.019G069866 [exp]	0	1
AT1G69550			disease resistance protein (TI...		Potri.005G030365 [exp]	4.89	0.9517
AT5G06370			NC domain-containing protein-r...		Potri.013G043100 [exp]	21.07	0.9477
AT3G21720		ICL	isocitrate lyase (.1)		Potri.007G122900 [exp]	21.54	0.9469	Pt-ICL1.2
AT1G04770			Tetratricopeptide repeat (TPR)...		Potri.009G033201 [exp]	26.07	0.9153
AT3G21720		ICL	isocitrate lyase (.1)		Potri.017G036900 [exp]	26.55	0.9446	ICL1.1
					Potri.006G271692 [exp]	30.00	0.9444
					Potri.006G271586 [exp]	30.39	0.9316
AT5G27550			P-loop containing nucleoside t...		Potri.005G030271 [exp]	39.94	0.9185
AT3G18830		ATPMT5, AtPLT5	ARABIDOPSIS THALIANA POLYOL/MO...		Potri.006G158700 [exp]	40.07	0.9391
AT3G28150		AXY4L, TBL22	ALTERED XYLOGLUCAN 4-LIKE, TRI...		Potri.011G144100 [exp]	42.32	0.9421

Compare expression of checked genes

Potri.019G069866 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.