Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20142 160 / 1e-48 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT5G41750 157 / 1e-44 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G44480 155 / 5e-44 COG1, RPP10, RPP1 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16950 154 / 9e-44 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G65850 152 / 3e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT3G44630 152 / 5e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT3G04220 151 / 8e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G44400 150 / 3e-42 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G16990 149 / 3e-42 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT5G38344 139 / 6e-42 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G069866 [exp] 296 / 7e-104 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G070300 [exp] 301 / 5e-98 AT5G17680 558 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069600 [exp] 304 / 3e-96 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070651 [exp] 301 / 5e-95 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070393 [exp] 292 / 7e-92 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 289 / 3e-91 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069733 [exp] 259 / 2e-88 AT2G20142 147 / 1e-42 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G069500 [exp] 277 / 8e-87 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G068300 [exp] 202 / 1e-60 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042752 [exp] 174 / 4e-56 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10041060 [exp] 175 / 4e-51 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029722 [exp] 174 / 1e-50 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 168 / 3e-49 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10011104 [exp] 166 / 7e-48 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014829 [exp] 162 / 3e-46 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10026201 [exp] 159 / 2e-45 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 155 / 4e-44 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10006929 [exp] 143 / 1e-42 AT1G72890 146 / 1e-39 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) Lus10030839 [exp] 151 / 2e-42 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.019G070436.1 pacid=42773305 polypeptide=Potri.019G070436.1.p locus=Potri.019G070436 ID=Potri.019G070436.1.v4.1 annot-version=v4.1 ATGGCATCTTCATCTGCTGTTGCTCGTAAAAGGAAGTATGATGTGTTCCTTAGTTTTAGAGGCAAGGATACGCGCAATAATTTTACCAGCCATCTCTATG ATGCTACACGTCGTAAGAAAATCAAGACCTTCATTGATGACGGGCTTGAAAGAGGAGAAGAAATTACCCCTGCCCTTCTGAAAACGATTGAAGAATCAAG AATTTCTGTAGTAATTTTCTCCAAGAACTACGCATCTTCTCCGTGGTGTGTGGATGAACTGGTGAAAATACTTGAATGCAAAGAGACTTATGGGCAGATT GTTTTACCGGTCTTCTATCATGTAGACCCCTCTGATGTTGATGAACAGACTGGGAGTTTTGGAAATGCGTTTGCTGAGCTTGAAATTTTTTTTAAGGGGA AGATGGACAAGGTGCCAAGGTGGAGGGATGACTTGAGAAAAGCAGCCAGTATATCTGGATGGGATTCACAGGTTACTAGTAAGAGAAGTTGTGCAAACTA TCTGGAAAAGGTTAAATGA
AA sequence Show only first row Show all	>Potri.019G070436.1 pacid=42773305 polypeptide=Potri.019G070436.1.p locus=Potri.019G070436 ID=Potri.019G070436.1.v4.1 annot-version=v4.1 MASSSAVARKRKYDVFLSFRGKDTRNNFTSHLYDATRRKKIKTFIDDGLERGEEITPALLKTIEESRISVVIFSKNYASSPWCVDELVKILECKETYGQI VLPVFYHVDPSDVDEQTGSFGNAFAELEIFFKGKMDKVPRWRDDLRKAASISGWDSQVTSKRSCANYLEKVK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.019G070436 [exp]	0	1
AT1G76880	Trihelix		Duplicated homeodomain-like su...		Potri.002G068600 [exp]	16.43	0.7461	GT2.3
AT5G13760			Plasma-membrane choline transp...		Potri.009G056700 [exp]	29.52	0.7402
AT5G27550			P-loop containing nucleoside t...		Potri.005G031500 [exp]	33.25	0.7404
AT3G14840			Leucine-rich repeat transmembr...		Potri.001G385500 [exp]	41.42	0.7424
AT1G03670			ankyrin repeat family protein ...		Potri.018G078200 [exp]	46.18	0.7398
AT1G09570		FHY2, HY8, FRE1...	ELONGATED HYPOCOTYL 8, FAR RED...		Potri.013G000300 [exp]	47.60	0.7384	PHYC.1,phya
AT1G08920		ESL1	ERD (early response to dehydra...		Potri.005G037000 [exp]	55.11	0.7195
AT1G74190		AtRLP15	receptor like protein 15 (.1)		Potri.005G006701 [exp]	55.99	0.7250
AT4G03250	HD		Homeodomain-like superfamily p...		Potri.009G071700 [exp]	61.03	0.7226
AT1G60670			Protein of unknown function (D...		Potri.008G145100 [exp]	62.13	0.7206

Compare expression of checked genes

Potri.019G070436 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.