Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G27170 62 / 4e-12 transmembrane receptors;ATP binding (.1.2) AT1G72890 61 / 1e-11 Disease resistance protein (TIR-NBS class) (.1), Disease resistance protein (TIR-NBS class) (.2) AT4G12010 61 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G65850 61 / 2e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72930 58 / 2e-11 TIR toll/interleukin-1 receptor-like (.1.2) AT1G72910 59 / 6e-11 Toll-Interleukin-Resistance (TIR) domain-containing protein (.1) AT5G51630 59 / 7e-11 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT5G36930 58 / 1e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT1G72920 58 / 1e-10 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT1G72860 58 / 1e-10 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G069866 [exp] 107 / 8e-30 AT4G12010 179 / 4e-52 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G069733 [exp] 102 / 1e-27 AT2G20142 147 / 1e-42 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G069600 [exp] 105 / 2e-27 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 105 / 3e-27 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070651 [exp] 102 / 2e-26 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070300 [exp] 102 / 2e-26 AT5G17680 558 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070436 [exp] 96 / 6e-26 AT2G20142 160 / 7e-49 Toll-Interleukin-Resistance (TIR) domain family protein (.1) Potri.019G069500 [exp] 96 / 9e-24 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070393 [exp] 87 / 8e-21 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042752 [exp] 69 / 1e-15 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10017419 [exp] 71 / 7e-15 AT4G12010 272 / 9e-80 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10029722 [exp] 69 / 2e-14 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 67 / 9e-14 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10017418 [exp] 63 / 3e-12 AT5G44510 335 / 1e-96 target of AVRB operation1 (.1) Lus10019708 [exp] 63 / 4e-12 AT5G17680 495 / 1e-150 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10011104 [exp] 62 / 4e-12 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 62 / 4e-12 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10003749 [exp] 62 / 8e-12 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10015650 [exp] 62 / 9e-12 AT4G12010 346 / 3e-103 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF01582 [poplar] [flax] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Potri.019G070522.1 pacid=42773537 polypeptide=Potri.019G070522.1.p locus=Potri.019G070522 ID=Potri.019G070522.1.v4.1 annot-version=v4.1 ATGGCATCTTCATCTGCTGTTTCTCATGTATGTAAGTATGATGTGTTCCTAAGTTTTAGAGGCAAGGATACGCGCAATAATTTTACCAGCCATCTCTATG ATGCCTTATGTCGTAAACAAATCAAGACTTTCATAGATAATGATCTTGAAAGGGGTGAAGAAATTGCGCTAATAGTGAGTTACTGGGTTTCATGCTGTGC ACTGTTGTTGCATTTGAACCCTCTTATGATGACTCTGGTGGATTCCAAGTTAAATGTACTTACCATTTCAAGAATGACCATGCCGATCCCTGCGTTCTCC ATTGCTACTTTGCCAGTTGCTATGGCTCATTGCACAAACGATCTATCCATTCAGATCACCTATTTCTTGGATATGATCGAATGCTACAAAAGATTTTTGG TATGGTAA
AA sequence Show only first row Show all	>Potri.019G070522.1 pacid=42773537 polypeptide=Potri.019G070522.1.p locus=Potri.019G070522 ID=Potri.019G070522.1.v4.1 annot-version=v4.1 MASSSAVSHVCKYDVFLSFRGKDTRNNFTSHLYDALCRKQIKTFIDNDLERGEEIALIVSYWVSCCALLLHLNPLMMTLVDSKLNVLTISRMTMPIPAFS IATLPVAMAHCTNDLSIQITYFLDMIECYKRFLVW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G27170			transmembrane receptors;ATP bi...		Potri.019G070522 [exp]	0	1
AT1G10417			unknown protein		Potri.008G190600 [exp]	13.92	0.8034
AT2G17220		Kin3	kinase 3, Protein kinase super...		Potri.018G134100 [exp]	16.58	0.7799
					Potri.012G066225 [exp]	20.04	0.7914
AT3G55550			Concanavalin A-like lectin pro...		Potri.016G101000 [exp]	30.06	0.6968	Pt-LECRK7.1
AT3G21760		HYR1	HYPOSTATIN RESISTANCE 1, UDP-G...		Potri.006G007100 [exp]	31.30	0.7353
AT1G63450		RHS8	root hair specific 8 (.1)		Potri.001G105300 [exp]	31.46	0.7745
AT5G04620		BIO4, ATBIOF	biotin 4, biotin F (.1.2)		Potri.001G126700 [exp]	32.86	0.7111
AT4G01810			Sec23/Sec24 protein transport ...		Potri.014G112600 [exp]	34.32	0.7305
AT3G54070			Ankyrin repeat family protein ...		Potri.014G058100 [exp]	37.97	0.7562
AT3G52630			Nucleic acid-binding, OB-fold-...		Potri.006G212100 [exp]	38.88	0.7425

Compare expression of checked genes

Potri.019G070522 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.