Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45250 78 / 2e-17 RPS4 RESISTANT TO P. SYRINGAE 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT3G51570 78 / 2e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45230 77 / 3e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G36150 77 / 5e-17 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G45060 75 / 3e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17880 72 / 3e-15 CSA1 constitutive shade-avoidance1, disease resistance protein (TIR-NBS-LRR class) (.1) AT5G45200 72 / 3e-15 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT2G17060 70 / 1e-14 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17680 70 / 2e-14 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G36930 66 / 2e-13 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G070350 [exp] 191 / 3e-60 AT5G45200 152 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G069500 [exp] 174 / 4e-51 AT5G17680 711 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070393 [exp] 169 / 4e-49 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G069600 [exp] 168 / 6e-49 AT5G17680 647 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070479 [exp] 168 / 6e-49 AT5G17680 285 / 2e-80 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070001 [exp] 164 / 1e-47 AT5G17680 481 / 5e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070565 [exp] 164 / 1e-47 AT5G17680 482 / 3e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070651 [exp] 162 / 7e-47 AT5G17680 630 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G070700 [exp] 100 / 6e-25 AT5G17680 722 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003749 [exp] 67 / 3e-13 AT5G17680 517 / 5e-161 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10029722 [exp] 65 / 8e-13 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005171 [exp] 62 / 8e-12 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2) Lus10018616 [exp] 57 / 5e-10 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10010223 [exp] 56 / 1e-09 AT5G17680 218 / 6e-58 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10024150 [exp] 55 / 3e-09 AT1G69550 186 / 9e-49 disease resistance protein (TIR-NBS-LRR class) (.1) Lus10042753 [exp] 54 / 4e-09 AT4G12010 121 / 3e-30 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10018021 [exp] 54 / 5e-09 AT4G12010 434 / 5e-131 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10039850 [exp] 54 / 6e-09 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10038249 [exp] 53 / 2e-08 AT5G17680 445 / 4e-137 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF13855 [poplar] [flax] LRR_8 Leucine rich repeat
Representative CDS sequence Show only first row Show all	>Potri.019G070608.1 pacid=42773959 polypeptide=Potri.019G070608.1.p locus=Potri.019G070608 ID=Potri.019G070608.1.v4.1 annot-version=v4.1 ATGGAATCTTTGAGATATCTTTACTTGGACAGAACAGGCATAAGAAAATTATCCTCACCAATTAGAAATCTAAAGGGGCTTTGTTGCTTAGCATTGGGAA ATTGTAAATATTTGGAAGGAAAATATCTTGGTGACTTGCGATTGCTTGAGCAGGATGTGGATTTAAAATATTTGCGCAAGCTAAACCTAAGTGGTTGCGG AATACTAGAAGTGCCTAAAAGTCTTGGCTGCTTAACCTCACTGGAAGCATTGGATCTGAGTGGAAACAACTTTGTTAGACTGCCTACAAATATCAGTGAA CTCTATGAGCTGCAATATCTTGGCTTACGCTATTGCAGGAGGCTTGGGTCATTACAAAAACTTCCACCACGGCTTGCAAAACTAGATGCTCACAGCTGCA CATCACTGAGAACAGTCCCAAGCTCATCAGCTATAGTTGATGGAAACATTTTTTGA
AA sequence Show only first row Show all	>Potri.019G070608.1 pacid=42773959 polypeptide=Potri.019G070608.1.p locus=Potri.019G070608 ID=Potri.019G070608.1.v4.1 annot-version=v4.1 MESLRYLYLDRTGIRKLSSPIRNLKGLCCLALGNCKYLEGKYLGDLRLLEQDVDLKYLRKLNLSGCGILEVPKSLGCLTSLEALDLSGNNFVRLPTNISE LYELQYLGLRYCRRLGSLQKLPPRLAKLDAHSCTSLRTVPSSSAIVDGNIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G45250		RPS4	RESISTANT TO P. SYRINGAE 4, Di...		Potri.019G070608 [exp]	0	1
AT5G17680			disease resistance protein (TI...		Potri.019G070565 [exp]	45.60	0.8710
					Potri.004G019766 [exp]	74.29	0.8522
AT5G36930			Disease resistance protein (TI...		Potri.011G008164 [exp]	88.18	0.8602
AT1G77670			Pyridoxal phosphate (PLP)-depe...		Potri.014G124100 [exp]	98.16	0.8534
					Potri.012G032376 [exp]	100.91	0.8457
AT1G72890			Disease resistance protein (TI...		Potri.006G282400 [exp]	101.57	0.8490
AT5G14930		GENE101, SAG101	senescence-associated gene 101...		Potri.001G291166 [exp]	113.84	0.8233
AT5G36930			Disease resistance protein (TI...		Potri.006G282300 [exp]	122.27	0.8491
AT4G02550			unknown protein		Potri.006G196716 [exp]	134.47	0.8307
AT1G27170			transmembrane receptors;ATP bi...		Potri.006G282100 [exp]	151.55	0.8420

Compare expression of checked genes

Potri.019G070608 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.