Plant FIBer expression Database

Potri.019G070801 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G10100 122 / 1e-37 CNX7, SIR5 "co-factor for nitrate, reductase and xanthine dehydrogenase 7", co-factor for nitrate, reductase and xanthine dehydrogenase 7 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10041075
[exp]
127 / 1e-39 AT4G10100 120 / 5e-37 "co-factor for nitrate, reductase and xanthine dehydrogenase 7", co-factor for nitrate, reductase and xanthine dehydrogenase 7 (.1.2.3)
Lus10030343
[exp]
127 / 1e-39 AT4G10100 119 / 3e-36 "co-factor for nitrate, reductase and xanthine dehydrogenase 7", co-factor for nitrate, reductase and xanthine dehydrogenase 7 (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF02597 ThiS ThiS family
Representative CDS sequence
>Potri.019G070801.1 pacid=42773470 polypeptide=Potri.019G070801.1.p locus=Potri.019G070801 ID=Potri.019G070801.1.v4.1 annot-version=v4.1
ATGATAGAAGTCAAGGCTGAAAATACAGATGGGGAACCAGTGGGAAGTGAAGGTTCATCTGTTAGTATAAAGGTCTTATTCTTTGCCAGAGCTCGAGATA
TAACTGGCTTGGCTGATATGCAATTAGAGGTGTCATCTGGTAGTACCACCAGCGATTGTTTGAATAAGCTTATTGCTAGGTTTCCTAGCTTGGAAGAGAT
CCGTGGTTGTATAGTTCTAGCTCTAAACGAGGAATACACAACCGAGGCAGCAATTGTCAAAGAAAAGGATGAGTTGGCAATCATACCTCCCATCAGTGGT
GGCTAA
AA sequence
>Potri.019G070801.1 pacid=42773470 polypeptide=Potri.019G070801.1.p locus=Potri.019G070801 ID=Potri.019G070801.1.v4.1 annot-version=v4.1
MIEVKAENTDGEPVGSEGSSVSIKVLFFARARDITGLADMQLEVSSGSTTSDCLNKLIARFPSLEEIRGCIVLALNEEYTTEAAIVKEKDELAIIPPISG
G

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G10100 CNX7, SIR5 "co-factor for nitrate, reduct... Potri.019G070801
[exp]
0 1
AT2G02760 ATUBC2 ubiquitin-conjugating enzyme 2... Potri.013G064400
[exp]
1.41 0.7671 UBC1.1
AT1G06110 SKIP16 SKP1/ASK-interacting protein 1... Potri.007G130900
[exp]
2.82 0.7390
AT2G20120 COV1 CONTINUOUS VASCULAR RING, Prot... Potri.006G158100
[exp]
3.46 0.7513
AT2G34450 HMG-box (high mobility group) ... Potri.004G131400
[exp]
10.24 0.6550
AT1G22040 Galactose oxidase/kelch repeat... Potri.005G170000
[exp]
21.97 0.6252
AT1G65020 unknown protein Potri.013G079101
[exp]
22.24 0.7079
AT3G07170 Sterile alpha motif (SAM) doma... Potri.014G190800
[exp]
22.44 0.7026
AT1G61780 postsynaptic protein-related (... Potri.004G021200
[exp]
23.23 0.7053
AT5G59890 ADF4, ATADF4 actin depolymerizing factor 4 ... Potri.010G208500
[exp]
23.62 0.6602
AT3G51610 NPU NO PRIMEXINE AND PLASMA MEMBRA... Potri.016G134700
[exp]
23.87 0.7153

Potri.019G070801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.