Potri.019G071900 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G22850 331 / 5e-113 SNARE associated Golgi protein family (.1)
AT5G19070 79 / 8e-17 SNARE associated Golgi protein family (.1)
AT1G03260 79 / 1e-16 SNARE associated Golgi protein family (.1)
AT2G02370 45 / 3e-05 SNARE associated Golgi protein family (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G099600 431 / 3e-152 AT1G22850 305 / 6e-102 SNARE associated Golgi protein family (.1)
Potri.008G202600 76 / 9e-16 AT5G19070 338 / 1e-117 SNARE associated Golgi protein family (.1)
Potri.010G030800 76 / 1e-15 AT5G19070 321 / 7e-111 SNARE associated Golgi protein family (.1)
Potri.001G078700 50 / 8e-07 AT2G02370 390 / 2e-136 SNARE associated Golgi protein family (.1.2)
Potri.003G151800 49 / 3e-06 AT2G02370 377 / 2e-131 SNARE associated Golgi protein family (.1.2)
Potri.003G117400 48 / 3e-06 AT1G12450 343 / 1e-118 SNARE associated Golgi protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006162 326 / 5e-111 AT1G22850 394 / 2e-137 SNARE associated Golgi protein family (.1)
Lus10041062 316 / 1e-107 AT1G22850 377 / 2e-131 SNARE associated Golgi protein family (.1)
Lus10004421 84 / 2e-18 AT5G19070 361 / 2e-126 SNARE associated Golgi protein family (.1)
Lus10034028 82 / 1e-17 AT5G19070 363 / 3e-127 SNARE associated Golgi protein family (.1)
Lus10028016 76 / 1e-15 AT1G03260 328 / 2e-113 SNARE associated Golgi protein family (.1)
Lus10021942 74 / 5e-15 AT5G19070 343 / 9e-120 SNARE associated Golgi protein family (.1)
Lus10012371 66 / 3e-12 AT1G03260 274 / 1e-92 SNARE associated Golgi protein family (.1)
Lus10012163 50 / 1e-06 AT2G02370 401 / 4e-141 SNARE associated Golgi protein family (.1.2)
Lus10008915 45 / 6e-05 AT1G12450 338 / 5e-117 SNARE associated Golgi protein family (.1)
Lus10028900 42 / 0.0005 AT1G12450 348 / 9e-121 SNARE associated Golgi protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Potri.019G071900.1 pacid=42773717 polypeptide=Potri.019G071900.1.p locus=Potri.019G071900 ID=Potri.019G071900.1.v4.1 annot-version=v4.1
ATGCGCACCCTCCTCAACTCAAGGCCACTAACACCATTACCACCATGTCTCGCTTCAAATTTCAACTCTTCTCCATTTCGCTCTCTGTTTCACTACAGCC
TTAGAACCAACAAGAGATTTCATTTCTTATCTCCTTGTTCTTCCTTAAAACAAAAAAAGAAACAACAGCAGACACTTAGAAAGACCAATGCCCCACAAAG
TGTAAGGTGGTTCTTGAACACAAAAGGTGATGATAGTGAAGCTGAAGAGGGGTTGGAAGGAGACACTGCATTTAAAGGTACTCTTTTGGCCGGAGTCTTG
TTGGTTGGTGTTGTTGGTGGGTTTGGTGCTGTTGGGTATATCTACAAGGACCAGATCAATGCTTTCTTGAACCAGTTTTCTGGGTTCATTGAAGGTTATG
GACCAGCTGGATATGCTTTATTTGTAGCGGTTTATGCAGGATTGGAAATCCTTGCAATTCCAGCGATTCCATTAACCATGTCAGCAGGTCTTCTTTTTGG
CTCTCTTATTGGCACCATTATTGTCTCTATAAGTGGAACGGCTGCTGCAAGCATTGCTTTTCTGATAGCTAGATATTTTGCTCGAGAGCGCATTCTTAAA
CTGGTTGAAGGAAATAAAAAATTTCTTGCAATTGACAAAGCGATCGGGGAAAATGGCTTCAAAGTTGTCACCCTTCTACGTTTGAGTCCTTTGCTTCCAT
TTTCTCTCGGGAATTATTTGTATGGATTGACATCTGTTAAGTTCATCCCCTATGTCTTGGGAAGTTGGTTGGGGATGCTTCCAGGAACATGGGCTTATGT
GAGTGCTGGTGCATTTGGCCGTGCAATCATTCAAGAGGAATCTGAGCTCAGATTAAGGGAAGGTAACAGTGGGCTTTGGACCCTTGGACTGGGATTATTG
GTCACAGCTATTGCTGCAACTTATGTAACGCGGCTGGCTAAGGATGCTGTAAAGGATATTGAGTAG
AA sequence
>Potri.019G071900.1 pacid=42773717 polypeptide=Potri.019G071900.1.p locus=Potri.019G071900 ID=Potri.019G071900.1.v4.1 annot-version=v4.1
MRTLLNSRPLTPLPPCLASNFNSSPFRSLFHYSLRTNKRFHFLSPCSSLKQKKKQQQTLRKTNAPQSVRWFLNTKGDDSEAEEGLEGDTAFKGTLLAGVL
LVGVVGGFGAVGYIYKDQINAFLNQFSGFIEGYGPAGYALFVAVYAGLEILAIPAIPLTMSAGLLFGSLIGTIIVSISGTAAASIAFLIARYFARERILK
LVEGNKKFLAIDKAIGENGFKVVTLLRLSPLLPFSLGNYLYGLTSVKFIPYVLGSWLGMLPGTWAYVSAGAFGRAIIQEESELRLREGNSGLWTLGLGLL
VTAIAATYVTRLAKDAVKDIE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G22850 SNARE associated Golgi protein... Potri.019G071900 0 1
AT5G30510 ARRPS1, RPS1 ribosomal protein S1 (.1) Potri.008G101100 2.00 0.9884
AT2G33800 EMB3113 EMBRYO DEFECTIVE 3113, Ribosom... Potri.004G045700 2.00 0.9878
AT5G14910 Heavy metal transport/detoxifi... Potri.001G350500 5.74 0.9825
AT4G04640 ATPC1 ATPase, F1 complex, gamma subu... Potri.004G014850 6.63 0.9821
AT1G32550 FdC1 ferredoxin C 1, 2Fe-2S ferredo... Potri.003G090400 7.07 0.9781
AT4G13220 unknown protein Potri.002G251800 7.07 0.9814
AT3G63410 VTE3, APG1, IEP... VITAMIN E DEFECTIVE 3, INNER E... Potri.002G047100 7.41 0.9777
AT4G21445 unknown protein Potri.011G041800 9.94 0.9785
AT5G51110 Transcriptional coactivator/pt... Potri.015G110500 10.67 0.9668
AT1G71500 Rieske (2Fe-2S) domain-contain... Potri.019G073900 11.53 0.9797

Potri.019G071900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.