Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22840 204 / 9e-70 CYTC-1, ATCYTC-A CYTOCHROME C-A, CYTOCHROME C-1 (.1.2) AT4G10040 203 / 1e-69 CYTC-2 cytochrome c-2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G076001 [exp] 225 / 5e-78 AT1G22840 211 / 2e-72 CYTOCHROME C-A, CYTOCHROME C-1 (.1.2) Potri.013G101601 [exp] 221 / 1e-76 AT4G10040 214 / 6e-74 cytochrome c-2 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028892 [exp] 204 / 1e-69 AT4G10040 214 / 7e-74 cytochrome c-2 (.1) Lus10008922 [exp] 204 / 1e-69 AT4G10040 214 / 7e-74 cytochrome c-2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0318 [poplar] [flax] Cytochrome-c PF00034 [poplar] [flax] Cytochrom_C Cytochrome c
Representative CDS sequence Show only first row Show all	>Potri.019G076101.1 pacid=42774705 polypeptide=Potri.019G076101.1.p locus=Potri.019G076101 ID=Potri.019G076101.1.v4.1 annot-version=v4.1 ATGGCTTCGTTTGCAGAAGCACCACCTGGCGATTCGAAAGTCGGAGAGAAGATCTTTAAGACCAAGTGTGCTCAGTGTCATACCGTCGACAAGGGTGCCG GTCATAAGCAAGGACCCAATCTGAATGGCTTGTTTGGAAGGCAGTCAGGAACAACTGCTGGATACTCTTACTCTGCTGCTCACAAGAACATGGCCGTCAC GTGGGAGGAGAAGACTTTGTATGATTACTTGCTCAACCCCAAGAAGTACATCCCTGGAACAAAGAAGGATTTCCCTGGATTGAAGAAGCCACAGGAGCGT GCTGATGTCATTGCATACTTGAAGCAGTCCACTGCATCTTAA
AA sequence Show only first row Show all	>Potri.019G076101.1 pacid=42774705 polypeptide=Potri.019G076101.1.p locus=Potri.019G076101 ID=Potri.019G076101.1.v4.1 annot-version=v4.1 MASFAEAPPGDSKVGEKIFKTKCAQCHTVDKGAGHKQGPNLNGLFGRQSGTTAGYSYSAAHKNMAVTWEEKTLYDYLLNPKKYIPGTKKDFPGLKKPQER ADVIAYLKQSTAS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22840		CYTC-1, ATCYTC-...	CYTOCHROME C-A, CYTOCHROME C-1...		Potri.019G076101 [exp]	0	1
AT1G14360		ATUTR3, UTR3	UDP-galactose transporter 3 (....		Potri.006G110500 [exp]	1.41	0.9041
AT5G58380		PKS2, CIPK10, S...	SNF1-RELATED PROTEIN KINASE 3....		Potri.019G048800 [exp]	4.69	0.8999
AT3G07630		AtADT2, ADT2	Arabidopsis thaliana arogenate...		Potri.008G195500 [exp]	5.47	0.8490
AT5G61840		GUT1, IRX10-L	Exostosin family protein (.1)		Potri.012G109600 [exp]	9.00	0.8842
AT3G16200			unknown protein		Potri.001G186200 [exp]	9.16	0.8808
AT2G43810			Small nuclear ribonucleoprotei...		Potri.008G078400 [exp]	10.00	0.8396
AT5G58590		RANBP1	RAN binding protein 1 (.1)		Potri.001G278900 [exp]	10.39	0.8707	Pt-SIRANBP.1
AT3G05520			Subunits of heterodimeric acti...		Potri.005G025300 [exp]	11.31	0.8678
AT5G26594		ARR24	response regulator 24 (.1)		Potri.001G050800 [exp]	14.07	0.8160
					Potri.008G099950 [exp]	15.49	0.7993

Compare expression of checked genes

Potri.019G076101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.