Potri.019G078200 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G47840 331 / 2e-114 AMK2 adenosine monophosphate kinase (.1)
AT5G35170 246 / 1e-77 adenylate kinase family protein (.1.2)
AT5G63400 119 / 5e-32 ADK1 adenylate kinase 1 (.1.2)
AT5G50370 114 / 3e-30 Adenylate kinase family protein (.1)
AT5G26667 96 / 2e-23 PYR6 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
AT4G25280 86 / 1e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G60180 85 / 1e-19 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2)
AT2G37250 79 / 9e-17 ADK, ATPADK1 adenosine kinase (.1)
AT2G39270 77 / 3e-16 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT3G01820 45 / 3e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G103400 466 / 1e-167 AT5G47840 347 / 1e-120 adenosine monophosphate kinase (.1)
Potri.018G113400 242 / 9e-76 AT5G35170 838 / 0.0 adenylate kinase family protein (.1.2)
Potri.006G189201 124 / 2e-35 AT5G35170 158 / 1e-46 adenylate kinase family protein (.1.2)
Potri.012G095300 124 / 7e-34 AT5G63400 419 / 1e-150 adenylate kinase 1 (.1.2)
Potri.015G092800 120 / 2e-32 AT5G63400 425 / 6e-153 adenylate kinase 1 (.1.2)
Potri.014G043300 93 / 2e-22 AT5G26667 358 / 2e-127 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.002G134600 92 / 4e-22 AT5G26667 345 / 1e-122 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Potri.008G046100 89 / 3e-20 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Potri.014G104700 84 / 4e-19 AT5G26667 275 / 8e-95 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037995 293 / 9e-101 AT5G47840 315 / 9e-110 adenosine monophosphate kinase (.1)
Lus10003504 279 / 4e-94 AT5G47840 300 / 1e-102 adenosine monophosphate kinase (.1)
Lus10009228 272 / 3e-91 AT5G47840 296 / 3e-101 adenosine monophosphate kinase (.1)
Lus10009478 266 / 2e-90 AT5G47840 293 / 1e-101 adenosine monophosphate kinase (.1)
Lus10036326 224 / 7e-70 AT5G35170 658 / 0.0 adenylate kinase family protein (.1.2)
Lus10016757 125 / 2e-34 AT5G63400 416 / 2e-149 adenylate kinase 1 (.1.2)
Lus10022453 125 / 3e-34 AT5G63400 411 / 2e-147 adenylate kinase 1 (.1.2)
Lus10031611 93 / 2e-22 AT5G26667 343 / 1e-121 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10033733 92 / 3e-21 AT5G26667 336 / 2e-117 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1.2.3)
Lus10023476 86 / 4e-19 AT2G37250 407 / 2e-144 adenosine kinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF00406 ADK Adenylate kinase
Representative CDS sequence
>Potri.019G078200.5 pacid=42773858 polypeptide=Potri.019G078200.5.p locus=Potri.019G078200 ID=Potri.019G078200.5.v4.1 annot-version=v4.1
ATGGCTGCTACAAGCTCCTGCAATTTCAACTGGGGAGTGAATGGAAAAGGGACCCCTGAACAGCCTTGTTCTTCCTCAAAGTCCTCCCAGATCCTCTTCT
CTTCTAACTTATCTTTTTGTTACAGTAACATCAGATATTGCCTCTCTCTTCGTTCCCATCAAACCCTTTTGTCCACTCGTTTCAACGAAACCAAGAATTC
AGCTTTTGTTGTGGCATCAGCAAAGGCAGACCCTTTGAAGATAATGATTTCCGGAGCTCCTGCTTCTGGTAAAGGTACTCAATGTGAGCTCATCACTAAG
AAATATGGTTTGGTGCACATTGCTGCCGGAGACCTTCTGAGGGCAGAAATTGCTTCAGGAAGTGAGAATGGAAAGCGAGCAAAGGAATACATGGAGAAAG
GACAGTTGGTCCCAAATGAAATAGTTGTCATGATGGTAAAGGAGCGTCTGCTGCTGCCAGACTCTCAAGAAAATGGTTGGCTTTTAGATGGATACCCAAG
GAGCTTACTACAAGCAACTGCTCTTAAAGAATTTGGCTTCCAGCCCGATCTTTTTATTCTCCTGGAAGTCAATGAAGAGATTCTTGTTGAAAGAGTGGTT
GGACGTAGGTTAGACCCTGTTACTGGGAAGATATACCACCTCAAGTATTCTCCCCCTGAGACTGAAGAAATTGCTGCCAGGCTCACCCAACGTTTTGATG
ACACTGAAGAAAAGGTGAAGTTGCGGTTGCAAACTCATCATCAAAATGTGGAGGCGGTACTTCTAATGTATGAAGACATTACACTCAAGGTTAATGGAAA
TGTTCCCAAAGAAGATGTGTTTGCACAAATTGATGGTGCTCTCACAAAATTACATGAGGATAGGAAGTTGATTTAA
AA sequence
>Potri.019G078200.5 pacid=42773858 polypeptide=Potri.019G078200.5.p locus=Potri.019G078200 ID=Potri.019G078200.5.v4.1 annot-version=v4.1
MAATSSCNFNWGVNGKGTPEQPCSSSKSSQILFSSNLSFCYSNIRYCLSLRSHQTLLSTRFNETKNSAFVVASAKADPLKIMISGAPASGKGTQCELITK
KYGLVHIAAGDLLRAEIASGSENGKRAKEYMEKGQLVPNEIVVMMVKERLLLPDSQENGWLLDGYPRSLLQATALKEFGFQPDLFILLEVNEEILVERVV
GRRLDPVTGKIYHLKYSPPETEEIAARLTQRFDDTEEKVKLRLQTHHQNVEAVLLMYEDITLKVNGNVPKEDVFAQIDGALTKLHEDRKLI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G47840 AMK2 adenosine monophosphate kinase... Potri.019G078200 0 1
AT5G58200 Calcineurin-like metallo-phosp... Potri.006G188200 3.46 0.6760
AT3G15750 Essential protein Yae1, N-term... Potri.003G201500 12.24 0.6038
AT3G14470 NB-ARC domain-containing disea... Potri.017G015600 16.70 0.6335
AT5G26742 EMB1138 embryo defective 1138, DEAD bo... Potri.005G000166 17.54 0.6123
AT5G17400 ER-ANT1 endoplasmic reticulum-adenine ... Potri.012G062500 19.28 0.6262
AT1G44790 ChaC-like family protein (.1) Potri.005G176300 19.79 0.6232
AT3G14470 NB-ARC domain-containing disea... Potri.017G015200 20.29 0.6442
AT1G11480 eukaryotic translation initiat... Potri.011G031900 28.37 0.5733
AT3G59470 FAR1_related Far-red impaired responsive (F... Potri.017G029100 32.49 0.5458
AT1G20823 RING/U-box superfamily protein... Potri.007G064401 39.79 0.6214

Potri.019G078200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.