Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25950 120 / 1e-36 VATG3 vacuolar ATP synthase G3 (.1) AT4G23710 105 / 1e-30 VAG2 ,VATG2 ,VHA-G2 vacuolar ATP synthase subunit G2 (.1) AT3G01390 98 / 1e-27 AVMA10, VMA10 vacuolar membrane ATPase 10 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G108300 [exp] 154 / 6e-50 AT3G01390 64 / 2e-14 vacuolar membrane ATPase 10 (.1.2) Potri.008G040300 [exp] 122 / 2e-37 AT3G01390 145 / 2e-46 vacuolar membrane ATPase 10 (.1.2) Potri.019G133701 [exp] 120 / 4e-37 AT4G25950 74 / 1e-18 vacuolar ATP synthase G3 (.1) Potri.010G222000 [exp] 121 / 7e-37 AT3G01390 147 / 2e-47 vacuolar membrane ATPase 10 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001543 [exp] 131 / 7e-41 AT4G25950 123 / 8e-38 vacuolar ATP synthase G3 (.1) Lus10009452 [exp] 130 / 1e-40 AT4G25950 123 / 7e-38 vacuolar ATP synthase G3 (.1) Lus10029418 [exp] 127 / 2e-39 AT3G01390 143 / 7e-46 vacuolar membrane ATPase 10 (.1.2) Lus10016977 [exp] 127 / 3e-39 AT3G01390 129 / 4e-40 vacuolar membrane ATPase 10 (.1.2) Lus10004213 [exp] 127 / 4e-39 AT3G01390 143 / 9e-46 vacuolar membrane ATPase 10 (.1.2) Lus10021301 [exp] 122 / 3e-37 AT4G23710 123 / 1e-37 vacuolar ATP synthase subunit G2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0255 [poplar] [flax] ATP_synthase PF03179 [poplar] [flax] V-ATPase_G Vacuolar (H+)-ATPase G subunit
Representative CDS sequence Show only first row Show all	>Potri.019G080700.2 pacid=42774380 polypeptide=Potri.019G080700.2.p locus=Potri.019G080700 ID=Potri.019G080700.2.v4.1 annot-version=v4.1 ATGGATTCCATGAGAGGTCATGAAGGGATTCAGATGCTACTAACTGCAGAACAGGAGGCCCAACAAATTGTTACTGCTGCTAGAAACTTGAAGACAACAA GGTTAAGGCAAGCTAAAGAAGAAGCCGAGAAAGATGCTGGCCATTATCGCTCCAACCTGGAATCTGAGTACCAAAAGAGAGTTGGTGAGACAAGTGGGAA CTCTGGCTTCACCGCGGAACGGCTTGAAGAGGAAACTGACGTAAAGATTCGAAACCTGAAGAAGTCAGCCTCTAAGGTCCAGTCAGATATTGTTGACATG CTCATCAAGTACACCACAGCCGCAAAGTATTGA
AA sequence Show only first row Show all	>Potri.019G080700.2 pacid=42774380 polypeptide=Potri.019G080700.2.p locus=Potri.019G080700 ID=Potri.019G080700.2.v4.1 annot-version=v4.1 MDSMRGHEGIQMLLTAEQEAQQIVTAARNLKTTRLRQAKEEAEKDAGHYRSNLESEYQKRVGETSGNSGFTAERLEEETDVKIRNLKKSASKVQSDIVDM LIKYTTAAKY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G25950		VATG3	vacuolar ATP synthase G3 (.1)		Potri.019G080700 [exp]	0	1
AT3G27120			P-loop containing nucleoside t...		Potri.001G331300 [exp]	3.60	0.8296
AT1G75220		AtERDL6	ERD6-like 6, Major facilitator...		Potri.005G122550 [exp]	5.83	0.7925
					Potri.015G072732 [exp]	12.16	0.7658
AT1G47230		CYCA3;4	CYCLIN A3;4 (.1.2)		Potri.008G008551 [exp]	13.22	0.7633
AT3G48750		CDKA1, CDC2A, C...	cell division control 2 (.1)		Potri.008G008400 [exp]	13.96	0.6875
AT1G15260			unknown protein		Potri.003G053600 [exp]	15.65	0.6260
					Potri.016G067650 [exp]	16.24	0.6594
AT5G49460		ACLB-2	ATP citrate lyase subunit B 2 ...		Potri.010G145766 [exp]	20.00	0.7115
AT1G67670			unknown protein		Potri.010G054700 [exp]	21.42	0.7073
AT2G23240		AtMT4b	Arabidopsis thaliana metalloth...		Potri.009G167700 [exp]	21.90	0.6825

Compare expression of checked genes

Potri.019G080700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.