Potri.019G081000 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G20230 249 / 4e-85 Ribosomal L18p/L5e family protein (.1)
AT1G08845 112 / 4e-31 Ribosomal L18p/L5e family protein (.1.2)
AT5G27820 71 / 1e-15 Ribosomal L18p/L5e family protein (.1)
AT3G22450 73 / 3e-15 Ribosomal L18p/L5e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G108700 331 / 3e-117 AT3G20230 226 / 6e-76 Ribosomal L18p/L5e family protein (.1)
Potri.013G029300 119 / 8e-34 AT1G08845 295 / 1e-102 Ribosomal L18p/L5e family protein (.1.2)
Potri.008G153100 93 / 2e-22 AT3G22450 253 / 2e-82 Ribosomal L18p/L5e family protein (.1)
Potri.007G100900 64 / 3e-13 AT5G27820 155 / 3e-50 Ribosomal L18p/L5e family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10020797 258 / 6e-88 AT3G20230 238 / 1e-80 Ribosomal L18p/L5e family protein (.1)
Lus10007379 255 / 6e-87 AT3G20230 234 / 3e-79 Ribosomal L18p/L5e family protein (.1)
Lus10001727 117 / 8e-33 AT1G08845 268 / 1e-92 Ribosomal L18p/L5e family protein (.1.2)
Lus10004129 115 / 2e-29 AT5G27240 265 / 4e-82 DNAJ heat shock N-terminal domain-containing protein (.1)
Lus10010558 95 / 7e-23 AT3G22450 238 / 8e-77 Ribosomal L18p/L5e family protein (.1)
Lus10006115 94 / 7e-23 AT3G22450 231 / 6e-74 Ribosomal L18p/L5e family protein (.1)
Lus10031487 65 / 1e-13 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
Lus10015194 65 / 1e-13 AT5G27820 184 / 1e-61 Ribosomal L18p/L5e family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0267 S11_L18p PF00861 Ribosomal_L18p Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast
Representative CDS sequence
>Potri.019G081000.1 pacid=42774690 polypeptide=Potri.019G081000.1.p locus=Potri.019G081000 ID=Potri.019G081000.1.v4.1 annot-version=v4.1
ATGTTTTTTACTCAAACGAGTGAGCCACCAGTTAGTCCCACGAAGAAGATGGCCTGCATAATATCTTCTTGTGCAGCTCTTTCAACTCAATCACTTCTCT
CCGCCGACTCACTCCCAACTAGCTCAACTCGCTCAATCAAACCCAATTCCCTTTCATGGGGCTCTTCATTTCCCACCATACACATCTCCATCTCCATCAA
CAACAACAACCCATCCTCTCTCAACAAGACTTCTTTCATTCAAGCTGCCTGGACAAGAAGATCTCGAGGTGAACTTGCCAAGAAACCTAACAAGAAATCG
TGGAAACAGAGGACAGATATGTATATGAGGCCATTCTTACTAAATGTTTTCTTTTCAAGGAGATTTATCCAGGCAAAAGTGATGCACCGGGGAACAAGTA
AAGTGGTATCAGTTGCTACCACAAATGCCAAGGATCTGAGACACAGTTTACCATCACTTACAGATCACAATGCCTGTAGAATTGTAGGGAAGCTCATTGC
TGAGAGATCCAAGGAAGCTGATGTGTATGCAATGTCTTATGAACCTAGAAAAGATGAGCGGATTGAAGGTAAACTTGGAATTGTTATTGATACCATTAAG
GAGAATGGGATCATATTTGTTTAA
AA sequence
>Potri.019G081000.1 pacid=42774690 polypeptide=Potri.019G081000.1.p locus=Potri.019G081000 ID=Potri.019G081000.1.v4.1 annot-version=v4.1
MFFTQTSEPPVSPTKKMACIISSCAALSTQSLLSADSLPTSSTRSIKPNSLSWGSSFPTIHISISINNNNPSSLNKTSFIQAAWTRRSRGELAKKPNKKS
WKQRTDMYMRPFLLNVFFSRRFIQAKVMHRGTSKVVSVATTNAKDLRHSLPSLTDHNACRIVGKLIAERSKEADVYAMSYEPRKDERIEGKLGIVIDTIK
ENGIIFV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G20230 Ribosomal L18p/L5e family prot... Potri.019G081000 0 1
AT1G76080 ATCDSP32, CDSP3... ARABIDOPSIS THALIANA CHLOROPLA... Potri.005G245700 4.79 0.9592
AT2G42750 DNAJ heat shock N-terminal dom... Potri.014G143400 9.38 0.9571
AT2G39000 Acyl-CoA N-acyltransferases (N... Potri.008G039300 11.48 0.9443
AT5G14660 DEF2, PDF1B, AT... peptide deformylase 1B (.1.2) Potri.001G346700 11.87 0.9572
AT1G30260 AGL79 unknown protein Potri.011G081001 12.64 0.9383
AT4G14870 SECE1 secE/sec61-gamma protein trans... Potri.008G153400 15.65 0.9492
AT5G42070 unknown protein Potri.003G141700 16.30 0.9434
Potri.001G027600 17.32 0.9127
AT5G39050 PMAT1 phenolic glucoside malonyltran... Potri.004G096425 19.39 0.9405
AT1G76760 ATY1, TRX-Y1 thioredoxin Y1 (.1) Potri.002G066800 19.44 0.9320

Potri.019G081000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.