Potri.019G083500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G71940 461 / 7e-166 SNARE associated Golgi protein family (.1.2)
AT4G09580 459 / 3e-165 SNARE associated Golgi protein family (.1)
AT4G17790 328 / 1e-113 SNARE associated Golgi protein family (.1)
AT1G03260 53 / 5e-08 SNARE associated Golgi protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G113000 539 / 0 AT4G09580 454 / 5e-163 SNARE associated Golgi protein family (.1)
Potri.003G094000 337 / 1e-117 AT4G17790 378 / 8e-134 SNARE associated Golgi protein family (.1)
Potri.001G140200 331 / 5e-115 AT4G17790 379 / 2e-134 SNARE associated Golgi protein family (.1)
Potri.001G078700 43 / 0.0002 AT2G02370 390 / 2e-136 SNARE associated Golgi protein family (.1.2)
Potri.010G030800 42 / 0.0002 AT5G19070 321 / 7e-111 SNARE associated Golgi protein family (.1)
Potri.008G202600 41 / 0.0004 AT5G19070 338 / 1e-117 SNARE associated Golgi protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017913 480 / 4e-173 AT4G09580 442 / 2e-158 SNARE associated Golgi protein family (.1)
Lus10014818 408 / 3e-145 AT1G71940 374 / 2e-132 SNARE associated Golgi protein family (.1.2)
Lus10004564 326 / 1e-112 AT4G17790 388 / 1e-137 SNARE associated Golgi protein family (.1)
Lus10000905 323 / 1e-111 AT4G17790 387 / 2e-137 SNARE associated Golgi protein family (.1)
Lus10004421 50 / 9e-07 AT5G19070 361 / 2e-126 SNARE associated Golgi protein family (.1)
Lus10034028 49 / 2e-06 AT5G19070 363 / 3e-127 SNARE associated Golgi protein family (.1)
Lus10028016 48 / 3e-06 AT1G03260 328 / 2e-113 SNARE associated Golgi protein family (.1)
Lus10021942 42 / 0.0004 AT5G19070 343 / 9e-120 SNARE associated Golgi protein family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09335 SNARE_assoc SNARE associated Golgi protein
Representative CDS sequence
>Potri.019G083500.1 pacid=42774317 polypeptide=Potri.019G083500.1.p locus=Potri.019G083500 ID=Potri.019G083500.1.v4.1 annot-version=v4.1
ATGGCATCGACAAGGAATATAGTAGGTGGTGAAACAGCGACAGGAAACGAGAGGGGGAGGGTGTTAACGATGAGAGATGAAGAGAAAGCTAAAGAGGACG
ATTCACCCTCTGCTAAAAGAGCTAAATTTGAGAGATTTCCGTTGACAAGATGGGAATTAGCTGCTGCTCTCGGAGTCTTTTTTGTCTTTTCTACGGGATT
GTTTTGTATCTACTTGACAATGCCTGCTGCTGAATACGGCAAGCTCAAGTTGCCTCGTACTATTTCAGATCTTCGCTTGCTCAAAGACAATCTCGCAACA
TATGCAAATGAATATCCAGCACAATTCATTCTGGGCTACTGCTCTACTTATATCTTCATGCAGACTTTTATGATTCCTGGAACAATTTTCATGTCATTGC
TAGCTGGAGCTCTTTTTGGCGTTGTTAGGGGGATTTTTTTAGTTGTTTTCAATGCCACAGCTGGAGCGTCTTCCTGCTTTTTCTTGTCCAAGTTGATTGG
CAGGCCTCTAGTTAATTGGTTGTGGCCTGAAAAGTTGAGATTTTTTCAGGCAGAGATTGCTAAGAGAAGGGATAAACTACTGAATTACATGCTCTTCTTG
AGAGTAACTCCAACGTTGCCCAATCTTTTTATCAATTTGGCATCTCCAATCGTGGACATACCTTTTCATATTTTCTTTTTGGCTACTTTATTGGGTCTTA
TTCCTGCTTCCTATATCACTGTCAGGGCCGGCCTTGCTCTTGGGGATCTCAAGTCAGTAAAGGATCTATACGATTACAAAACTTTGTCTGTGCTCTTCAT
TATTGGGTCCATTTCCATATTCCCTACCCTTCTAAAGAGAAAGCGAATATATGAGTGA
AA sequence
>Potri.019G083500.1 pacid=42774317 polypeptide=Potri.019G083500.1.p locus=Potri.019G083500 ID=Potri.019G083500.1.v4.1 annot-version=v4.1
MASTRNIVGGETATGNERGRVLTMRDEEKAKEDDSPSAKRAKFERFPLTRWELAAALGVFFVFSTGLFCIYLTMPAAEYGKLKLPRTISDLRLLKDNLAT
YANEYPAQFILGYCSTYIFMQTFMIPGTIFMSLLAGALFGVVRGIFLVVFNATAGASSCFFLSKLIGRPLVNWLWPEKLRFFQAEIAKRRDKLLNYMLFL
RVTPTLPNLFINLASPIVDIPFHIFFLATLLGLIPASYITVRAGLALGDLKSVKDLYDYKTLSVLFIIGSISIFPTLLKRKRIYE

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G71940 SNARE associated Golgi protein... Potri.019G083500 0 1
AT4G00750 S-adenosyl-L-methionine-depend... Potri.002G154400 10.39 0.6842
AT3G01120 AtCGS1, ATCYS1,... METHIONINE OVERACCUMULATION 1,... Potri.017G086500 11.61 0.6426 CGS1.1
AT4G29210 GGT4, GGT3 gamma-glutamyl transpeptidase ... Potri.018G069450 21.79 0.6874
AT5G64813 LIP1 Light Insensitive Period1, Ras... Potri.005G085100 33.04 0.7183
AT5G20520 WAV2 WAVY GROWTH 2, alpha/beta-Hydr... Potri.006G145200 38.67 0.6622
AT1G25682 Family of unknown function (DU... Potri.008G115700 39.15 0.6598
Potri.009G086900 42.07 0.6647
AT5G27840 TOPP8 Calcineurin-like metallo-phosp... Potri.005G024100 47.87 0.7095 Pt-TOPP8.1
AT4G13360 ATP-dependent caseinolytic (Cl... Potri.006G156350 65.84 0.6566
AT5G19780 TUA5 tubulin alpha-5 (.1) Potri.003G220300 78.96 0.6828 TUA2

Potri.019G083500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.