Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	UBC.5
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G56150 280 / 8e-99 UBC30 ubiquitin-conjugating enzyme 30 (.1.2) AT5G41700 276 / 3e-97 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) AT1G64230 276 / 5e-97 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) AT3G08690 275 / 9e-97 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2) AT5G53300 273 / 4e-96 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4) AT4G27960 273 / 5e-96 UBC9 ubiquitin conjugating enzyme 9 (.1.2) AT2G16740 266 / 4e-93 UBC29 ubiquitin-conjugating enzyme 29 (.1) AT3G08700 246 / 3e-85 UBC12 ubiquitin-conjugating enzyme 12 (.1) AT3G13550 172 / 2e-55 EMB144, COP10, CIN4, FUS9 FUSCA 9, EMBRYO DEFECTIVE 144, CONSTITUTIVE PHOTOMORPHOGENIC 10, CYTOKININ-INSENSITIVE 4, Ubiquitin-conjugating enzyme family protein (.1.2) AT1G36340 148 / 2e-46 UBC31 ubiquitin-conjugating enzyme 31 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G131400 [exp] 280 / 1e-98 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.006G110200 [exp] 279 / 3e-98 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5) Potri.001G471200 [exp] 279 / 3e-98 AT1G64230 292 / 2e-103 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.016G138900 [exp] 278 / 4e-98 AT1G64230 304 / 3e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.011G168200 [exp] 278 / 1e-97 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.003G136200 [exp] 277 / 1e-97 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.001G094900 [exp] 275 / 1e-96 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Potri.015G023300 [exp] 274 / 2e-96 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Potri.012G033000 [exp] 274 / 2e-96 AT5G53300 302 / 1e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10028700 [exp] 276 / 4e-97 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10009422 [exp] 276 / 4e-97 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2) Lus10039323 [exp] 274 / 4e-96 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10027570 [exp] 274 / 4e-96 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10022726 [exp] 273 / 5e-96 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10014187 [exp] 273 / 5e-96 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10032352 [exp] 273 / 7e-96 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4) Lus10014942 [exp] 273 / 8e-96 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10038827 [exp] 273 / 8e-96 AT1G64230 301 / 3e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5) Lus10021385 [exp] 272 / 2e-95 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0208 [poplar] [flax] UBC PF05773 [poplar] [flax] RWD RWD domain
Representative CDS sequence Show only first row Show all	>Potri.019G083800.2 pacid=42774584 polypeptide=Potri.019G083800.2.p locus=Potri.019G083800 ID=Potri.019G083800.2.v4.1 annot-version=v4.1 ATGGCTTCAAAACGGATTAACAAGGAATTGAGGGACTTGCAGAAGGATCCTCCTACTGCTTGCAGTGCAGGCCCTGCTGGTAGTGACATGTTCCATTGGC AAGCAACAATTATGGGTCCAGCAGACAGCCCATACGCTGGGGGTGTGTTCTCTGTTAACATACACTTCCCTCCTGATTACCCATTCAAGCCACCCAAGGT TTCCTTTAAGACAAAAGTTTATCATCCAAACATTAACAGCAATGGCAGTATCTGTCTTGACATTCTCAAGGAGCAATGGAGCCCAGCCTTGACAATTTCA AAGGTGTTGTTGTCGATATGCTCGCTGTTGACAGATCCAAATCCCAATGATCCCCTGGTGCCTGAGATTGCTCATATCTACACGACTGATAGAGTCAAGT ATGATGCTACTGCTCGAGCCTGGACTCAGAAATATGCTATGAGCTAG
AA sequence Show only first row Show all	>Potri.019G083800.2 pacid=42774584 polypeptide=Potri.019G083800.2.p locus=Potri.019G083800 ID=Potri.019G083800.2.v4.1 annot-version=v4.1 MASKRINKELRDLQKDPPTACSAGPAGSDMFHWQATIMGPADSPYAGGVFSVNIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTIS KVLLSICSLLTDPNPNDPLVPEIAHIYTTDRVKYDATARAWTQKYAMS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G56150		UBC30	ubiquitin-conjugating enzyme 3...		Potri.019G083800 [exp]	0	1	UBC.5
AT1G09330		ECHIDNA, ECH	unknown protein		Potri.005G010400 [exp]	8.54	0.9301
AT2G21160			Translocon-associated protein ...		Potri.009G129800 [exp]	9.16	0.9202
AT3G09740		ATSYP71, SYP71	syntaxin of plants 71 (.1)		Potri.006G129500 [exp]	9.79	0.9262	Pt-SYP71.3
AT2G25737			Sulfite exporter TauE/SafE fam...		Potri.018G037500 [exp]	10.09	0.9245
AT1G20530			Protein of unknown function (D...		Potri.005G249400 [exp]	10.19	0.9245
					Potri.001G402100 [exp]	11.87	0.8793
AT4G27080		ATPDI7, ATPDIL5...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.011G135500 [exp]	19.74	0.9234
AT2G42310			unknown protein		Potri.016G051400 [exp]	21.00	0.9077
AT1G03030			P-loop containing nucleoside t...		Potri.005G218700 [exp]	21.07	0.8920
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.006G104500 [exp]	22.80	0.9081

Compare expression of checked genes

Potri.019G083800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.