Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) AT1G75750 89 / 2e-24 GASA1 GAST1 protein homolog 1 (.1.2) AT2G18420 78 / 3e-20 Gibberellin-regulated family protein (.1) AT5G14920 80 / 3e-19 Gibberellin-regulated family protein (.1.2) AT4G09600 76 / 5e-19 GASA3 GAST1 protein homolog 3 (.1) AT1G74670 66 / 2e-15 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 63 / 5e-14 GASA4 GAST1 protein homolog 4 (.1.2) AT4G09610 61 / 2e-13 GASA2 GAST1 protein homolog 2 (.1) AT2G14900 57 / 1e-11 Gibberellin-regulated family protein (.1) AT1G10588 56 / 2e-11 Gibberellin-regulated family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G239100 [exp] 90 / 1e-24 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.002G022600 [exp] 87 / 2e-23 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2) Potri.015G071500 [exp] 82 / 2e-21 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.005G239000 [exp] 82 / 2e-21 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1) Potri.012G076700 [exp] 82 / 2e-21 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) Potri.002G022500 [exp] 81 / 1e-20 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.013G113400 [exp] 77 / 8e-20 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.001G350600 [exp] 77 / 2e-18 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2) Potri.002G022700 [exp] 73 / 6e-18 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009421 [exp] 100 / 9e-28 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3) Lus10034524 [exp] 81 / 5e-21 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2) Lus10017212 [exp] 81 / 5e-21 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2) Lus10039443 [exp] 77 / 5e-19 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10033145 [exp] 74 / 2e-18 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2) Lus10014262 [exp] 72 / 2e-17 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1) Lus10025962 [exp] 69 / 3e-16 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1) Lus10002059 [exp] 66 / 4e-15 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10024338 [exp] 65 / 1e-14 ND 78 / 3e-20 Lus10004048 [exp] 64 / 1e-14 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [poplar] [flax] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Potri.019G083900.1 pacid=42773552 polypeptide=Potri.019G083900.1.p locus=Potri.019G083900 ID=Potri.019G083900.1.v4.1 annot-version=v4.1 ATGAAGCTACTCTTGATTTTTATCTCCATCCTGCTCATTCAGGCTTTTGTAGGGAATTCATTCCTTAGCAATGCTGCAAATTCTCCAGCTAATATGGATG AAGAAAGCGATGTGGTAGCTATTGATAAGAAACATTATCCTAAAAGAATCAATTGTGGTTATTTATGCGCAAGGAGATGCAGGGCATCGTCAAGAAAGAA TGTATGCCACAGAGCATGCAAAACCTGCTGCAACAGATGCCGGTGTGTTCCACCAGGTACCTATGGCAACAAGAGTGCATGCCCATGTTATGCAAGCCTT AGGACCCATGGAAACAAGCCCAAGTGCCCTTAA
AA sequence Show only first row Show all	>Potri.019G083900.1 pacid=42773552 polypeptide=Potri.019G083900.1.p locus=Potri.019G083900 ID=Potri.019G083900.1.v4.1 annot-version=v4.1 MKLLLIFISILLIQAFVGNSFLSNAANSPANMDEESDVVAIDKKHYPKRINCGYLCARRCRASSRKNVCHRACKTCCNRCRCVPPGTYGNKSACPCYASL RTHGNKPKCP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G22690			Gibberellin-regulated family p...		Potri.019G083900 [exp]	0	1
AT5G08391			Protein of unknown function (D...		Potri.003G170500 [exp]	1.41	0.9870
AT5G03120			unknown protein		Potri.006G130400 [exp]	9.89	0.9671
AT2G10940			Bifunctional inhibitor/lipid-t...		Potri.018G126000 [exp]	13.71	0.9821
AT2G05100		LHCB2.3, LHCB2....	LIGHT-HARVESTING CHLOROPHYLL B...		Potri.014G165100 [exp]	16.24	0.9815	LHCB2.2,Lhcb2-1
AT2G45180			Bifunctional inhibitor/lipid-t...		Potri.018G025900 [exp]	21.72	0.9803
AT1G68530		KCS6, CER6, POP...	POLLEN-PISTIL INCOMPATIBILITY ...		Potri.010G125300 [exp]	26.83	0.9780	CUT1.1
AT1G27950		LTPG1	glycosylphosphatidylinositol-a...		Potri.001G056200 [exp]	30.04	0.9780
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.004G064500 [exp]	32.03	0.9778
AT1G29660			GDSL-like Lipase/Acylhydrolase...		Potri.018G089500 [exp]	32.37	0.9779
AT1G02260			Divalent ion symporter (.1)		Potri.012G144000 [exp]	36.33	0.9777

Compare expression of checked genes

Potri.019G083900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.