Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14200 60 / 4e-11 RING/U-box superfamily protein (.1) AT5G54990 60 / 8e-11 RING/U-box superfamily protein (.1) AT3G30460 59 / 8e-11 RING/U-box superfamily protein (.1) AT1G60360 60 / 1e-10 RING/U-box superfamily protein (.1) AT3G19910 58 / 6e-10 RING/U-box superfamily protein (.1) AT1G18770 55 / 6e-10 RING/U-box superfamily protein (.1) AT3G58720 57 / 7e-10 RING/U-box superfamily protein (.1.2) AT1G26800 57 / 7e-10 RING/U-box superfamily protein (.1) AT4G32600 58 / 9e-10 RING/U-box superfamily protein (.1) AT4G05350 57 / 9e-10 RING/U-box superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G116000 [exp] 140 / 1e-41 AT3G30460 61 / 2e-11 RING/U-box superfamily protein (.1) Potri.019G086500 [exp] 120 / 1e-33 AT4G05350 64 / 2e-12 RING/U-box superfamily protein (.1) Potri.005G062400 [exp] 63 / 7e-12 AT1G60360 82 / 3e-18 RING/U-box superfamily protein (.1) Potri.005G090500 [exp] 60 / 1e-10 AT3G19950 279 / 4e-93 RING/U-box superfamily protein (.1) Potri.001G103900 [exp] 57 / 5e-10 AT4G26400 85 / 2e-19 RING/U-box superfamily protein (.1.2) Potri.008G019000 [exp] 56 / 8e-10 AT5G06490 131 / 8e-39 RING/U-box superfamily protein (.1) Potri.010G243200 [exp] 56 / 8e-10 AT5G06490 138 / 2e-41 RING/U-box superfamily protein (.1) Potri.007G074014 [exp] 57 / 9e-10 AT3G19950 278 / 5e-93 RING/U-box superfamily protein (.1) Potri.001G185200 [exp] 56 / 1e-09 AT3G02340 66 / 2e-12 RING/U-box superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011392 [exp] 61 / 5e-11 AT5G59550 75 / 2e-15 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10012376 [exp] 57 / 3e-10 AT3G46620 60 / 3e-11 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10006279 [exp] 57 / 1e-09 AT1G18760 62 / 2e-11 Zinc finger, C3HC4 type (RING finger) family protein (.1) Lus10025612 [exp] 57 / 2e-09 AT1G60360 234 / 7e-75 RING/U-box superfamily protein (.1) Lus10028063 [exp] 57 / 2e-09 AT1G60360 224 / 9e-71 RING/U-box superfamily protein (.1) Lus10028009 [exp] 55 / 2e-09 AT5G59550 57 / 5e-10 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10042171 [exp] 55 / 5e-09 AT1G14200 60 / 2e-11 RING/U-box superfamily protein (.1) Lus10020258 [exp] 56 / 7e-09 AT1G19800 469 / 4e-161 ATP-binding cassette I14, trigalactosyldiacylglycerol 1 (.1.2.3) Lus10018167 [exp] 55 / 7e-09 AT3G19950 75 / 1e-15 RING/U-box superfamily protein (.1) Lus10002637 [exp] 55 / 9e-09 AT1G55530 257 / 4e-82 RING/U-box superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13639 [poplar] [flax] zf-RING_2 Ring finger domain
Representative CDS sequence Show only first row Show all	>Potri.019G086601.1 pacid=42774493 polypeptide=Potri.019G086601.1.p locus=Potri.019G086601 ID=Potri.019G086601.1.v4.1 annot-version=v4.1 ATGCATGATTCGTGTAACGCTAAACCCTTGTTCCTAGTCTCAATTCTCTTACAACGAAAGAACAAAGTGACATGGAAAGACTCTAGATCAGGAGAGTTGT TGCTAGAAAATGAACACCCATCTTGCCCGGACTCACACAGGTCATGCCTAGTTCCTCCTCAACTTGTTTCCTTACCTGATTCTTGCACTAGTTATATGTG CGGCATTGTCTCCGATATGCTTAATCTTGATGATGTTTCTTTATGCCATGATGTTGCCTCAAACATTGGTTCTTTTGTTAGTGATTTTGCTAAGGAACGA GCTGGTCGTCAAGGGTTTTGCGTGTCGGCTCATGTAGTGATTGTCGAGGATTATGTTGAGGAAGTGATCTTGGATGGGATAAACGTGCCAATATTTGATT TTGATGAAGAAGATCATGCGGTTGTGTCAAGAGGTGCATCAATATCAACGTTGAACAAGTTGAAGAAAGAGAGGTTTTACATGAAGGAGATCACGCAGGA CGATGGTGATGAATCTTGTTGTGATTCTTGTGTGGTTTGCTTGGAAAGATTTTCTGCTACGGTTGGACTTACAAGGTTACCTTGCAAACACATATTTCAT GAACAATGCATCTTCGACTGGTTGAAGAAGTCCCCATCATGCCCACTTTGTCGATACGAGGTAGAATAG
AA sequence Show only first row Show all	>Potri.019G086601.1 pacid=42774493 polypeptide=Potri.019G086601.1.p locus=Potri.019G086601 ID=Potri.019G086601.1.v4.1 annot-version=v4.1 MHDSCNAKPLFLVSILLQRKNKVTWKDSRSGELLLENEHPSCPDSHRSCLVPPQLVSLPDSCTSYMCGIVSDMLNLDDVSLCHDVASNIGSFVSDFAKER AGRQGFCVSAHVVIVEDYVEEVILDGINVPIFDFDEEDHAVVSRGASISTLNKLKKERFYMKEITQDDGDESCCDSCVVCLERFSATVGLTRLPCKHIFH EQCIFDWLKKSPSCPLCRYEVE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14200			RING/U-box superfamily protein...		Potri.019G086601 [exp]	0	1
AT2G26790			Pentatricopeptide repeat (PPR)...		Potri.010G243002 [exp]	1.73	0.8620
					Potri.001G027950 [exp]	5.29	0.8303
					Potri.010G186750 [exp]	7.41	0.7916
AT2G15790		CYP40, SQN	SQUINT, CYCLOPHILIN 40, peptid...		Potri.009G106200 [exp]	15.55	0.7668	SQN.1
AT3G01600	NAC	ANAC044	NAC domain containing protein ...		Potri.001G343800 [exp]	17.74	0.7091
AT1G45231			S-adenosyl-L-methionine-depend...		Potri.014G028000 [exp]	19.07	0.7834
AT2G47770		ATTSPO	TSPO(outer membrane tryptophan...		Potri.010G025200 [exp]	24.04	0.7578
AT5G46570		BSK2	BR-signaling kinase 2 (.1)		Potri.014G179300 [exp]	28.56	0.7793
AT2G24100		ASG1	ALTERED SEED GERMINATION 1, un...		Potri.005G014600 [exp]	32.86	0.7573
AT2G42490			Copper amine oxidase family pr...		Potri.015G082900 [exp]	35.49	0.7432

Compare expression of checked genes

Potri.019G086601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.