Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G12600 213 / 7e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) AT5G20160 211 / 4e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3) AT4G22380 211 / 6e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) AT5G08180 64 / 1e-13 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G116800 [exp] 227 / 3e-78 AT4G12600 216 / 3e-74 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Potri.008G110100 [exp] 59 / 9e-12 AT5G08180 225 / 8e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017031 [exp] 217 / 2e-74 AT4G22380 220 / 2e-75 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10015295 [exp] 216 / 2e-71 AT4G22380 217 / 7e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10025435 [exp] 203 / 2e-66 AT4G22380 203 / 7e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1) Lus10019420 [exp] 203 / 4e-66 AT5G55190 443 / 8e-159 RAN GTPase 3 (.1) Lus10043276 [exp] 201 / 7e-65 AT5G55190 428 / 9e-153 RAN GTPase 3 (.1) Lus10040161 [exp] 58 / 3e-11 AT5G08180 226 / 4e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10004366 [exp] 58 / 3e-11 AT5G08180 227 / 1e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10010993 [exp] 54 / 9e-10 AT5G08180 229 / 3e-78 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2) Lus10000421 [exp] 54 / 1e-09 AT5G08180 240 / 9e-83 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0101 [poplar] [flax] PELOTA PF01248 [poplar] [flax] Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence Show only first row Show all	>Potri.019G087100.1 pacid=42773989 polypeptide=Potri.019G087100.1.p locus=Potri.019G087100 ID=Potri.019G087100.1.v4.1 annot-version=v4.1 ATGACAGTAGAAGCAGTGAATCCAAAAGCATACCCACTTGCAGATGCCCAGTTGGCCATAACAATACTTGACCTTGTTCAGCAAGCTGCTAATTACAAGC AACTCAAGAAAGGAGCCAATGAAGCTACCAAGACACTTAACAGAGGTATCTCTGAGTTTGTTGTGATGGCTGCTGATACTGAACCACTTGAGATTCTTCT CCATCTTCCTTTGCTTGCTGAAGACAAGAATGTCCCCTATGTATTTGTCTCTTCAAAGCAAGCACTTGGCCGAGCATGCGGTGTCACAAGACCTGTCATT GCTTGTTCAGTGACAACAAATGAGGGGAGTCAATTGAAAACACAGATTCAACAACTCAAGGATGCCATTGAGAAACTTCTGATCTGA
AA sequence Show only first row Show all	>Potri.019G087100.1 pacid=42773989 polypeptide=Potri.019G087100.1.p locus=Potri.019G087100 ID=Potri.019G087100.1.v4.1 annot-version=v4.1 MTVEAVNPKAYPLADAQLAITILDLVQQAANYKQLKKGANEATKTLNRGISEFVVMAADTEPLEILLHLPLLAEDKNVPYVFVSSKQALGRACGVTRPVI ACSVTTNEGSQLKTQIQQLKDAIEKLLI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G12600			Ribosomal protein L7Ae/L30e/S1...		Potri.019G087100 [exp]	0	1
AT2G19740			Ribosomal protein L31e family ...		Potri.009G064100 [exp]	1.41	0.9252
AT4G35850			Pentatricopeptide repeat (PPR)...		Potri.001G341400 [exp]	3.31	0.8602
AT4G18100			Ribosomal protein L32e (.1)		Potri.014G191000 [exp]	3.74	0.9078
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Potri.002G099500 [exp]	4.47	0.8978
AT3G62840			Small nuclear ribonucleoprotei...		Potri.014G129100 [exp]	5.19	0.8749
AT4G12600			Ribosomal protein L7Ae/L30e/S1...		Potri.013G116800 [exp]	5.91	0.8929
AT1G02780		EMB2386	embryo defective 2386, Ribosom...		Potri.012G037500 [exp]	8.66	0.9027	Pt-RPL19.4
AT1G10840		TIF3H1	translation initiation factor ...		Potri.014G147100 [exp]	10.09	0.8556	TIF3.5
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Potri.001G046600 [exp]	10.77	0.8424
AT5G39740		OLI7, RPL5B	OLIGOCELLULA 7, ribosomal prot...		Potri.013G128600 [exp]	10.95	0.8568

Compare expression of checked genes

Potri.019G087100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.