Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58100 145 / 2e-44 PDCB5 plasmodesmata callose-binding protein 5 (.1) AT2G30933 90 / 2e-22 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT4G05430 88 / 2e-22 Carbohydrate-binding X8 domain superfamily protein (.1) AT4G26830 91 / 1e-21 O-Glycosyl hydrolases family 17 protein (.1) AT2G05790 91 / 2e-21 O-Glycosyl hydrolases family 17 protein (.1) AT1G29380 87 / 6e-21 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G66855 83 / 7e-21 Carbohydrate-binding X8 domain superfamily protein (.1) AT5G55180 88 / 1e-20 O-Glycosyl hydrolases family 17 protein (.1.2) AT1G18650 82 / 1e-19 PDCB3 plasmodesmata callose-binding protein 3 (.1) AT5G67460 84 / 2e-19 O-Glycosyl hydrolases family 17 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G119500 [exp] 174 / 3e-56 AT3G58100 128 / 6e-38 plasmodesmata callose-binding protein 5 (.1) Potri.019G007800 [exp] 94 / 3e-24 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.019G012000 [exp] 93 / 3e-24 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.006G016800 [exp] 90 / 1e-23 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.014G164600 [exp] 85 / 9e-22 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.001G006500 [exp] 91 / 1e-21 AT3G13560 632 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Potri.001G240000 [exp] 91 / 2e-21 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2) Potri.002G059600 [exp] 88 / 2e-21 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.003G218500 [exp] 90 / 3e-21 AT3G13560 594 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039907 [exp] 176 / 1e-56 AT3G58100 158 / 1e-49 plasmodesmata callose-binding protein 5 (.1) Lus10002193 [exp] 169 / 9e-54 AT3G58100 155 / 1e-48 plasmodesmata callose-binding protein 5 (.1) Lus10007342 [exp] 92 / 6e-23 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10020765 [exp] 92 / 7e-23 AT2G30933 169 / 4e-52 Carbohydrate-binding X8 domain superfamily protein (.1.2) Lus10015151 [exp] 90 / 2e-21 AT2G05790 731 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10039179 [exp] 90 / 4e-21 AT3G13560 634 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3) Lus10012324 [exp] 83 / 1e-20 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10023276 [exp] 84 / 3e-20 AT4G05430 146 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10012937 [exp] 86 / 6e-20 AT5G56590 617 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Lus10038529 [exp] 84 / 6e-20 AT4G05430 146 / 9e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [poplar] [flax] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Potri.019G091500.1 pacid=42773878 polypeptide=Potri.019G091500.1.p locus=Potri.019G091500 ID=Potri.019G091500.1.v4.1 annot-version=v4.1 ATGTCTAAAATCTATTCTTTTTTTCTCTGTGTATTGCCACTTCTAGTGGCTTTGTCACTGCCAGAGTGTTTGAGGGCCCAGAAGGGTATAGCACCAAGGG ATCTATGGTGTGTAGCCAAGAACAACGCGGCTGATCAGGCACTGCAAGAATCTATTGATTGGGCATGTGGACCAGGTGGGGCTAATTGTGGACCAATACA ACAAGGAGGGCCGTGCTATGATTCTAGTGATGTTCAGAGAACAGCTTCTTGGGCTTTTAATGATTATTACTTGAAGAATGGATTGACTGATGATGCTTGT TACTTCAGCAACACTGCTGCTCTCACTTCTTTGAATCCAAGTTTTGATAAATGCAAATTTCCTTCCAGCTTATCGGTGAATAATGGAAGCATTTCTTCGC CAGCAGGAACAATACAGATGAGACCAGATAGTGCAGATTTGAGCAGCAGCAATAGGGTTGTTGGCACATGGTTTCTGCCTTTGGTCACCGGTTATTTGCT CGTTGCATTTACATGGCTAGTTCAATGA
AA sequence Show only first row Show all	>Potri.019G091500.1 pacid=42773878 polypeptide=Potri.019G091500.1.p locus=Potri.019G091500 ID=Potri.019G091500.1.v4.1 annot-version=v4.1 MSKIYSFFLCVLPLLVALSLPECLRAQKGIAPRDLWCVAKNNAADQALQESIDWACGPGGANCGPIQQGGPCYDSSDVQRTASWAFNDYYLKNGLTDDAC YFSNTAALTSLNPSFDKCKFPSSLSVNNGSISSPAGTIQMRPDSADLSSSNRVVGTWFLPLVTGYLLVAFTWLVQ

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G58100		PDCB5	plasmodesmata callose-binding ...		Potri.019G091500 [exp]	0	1
AT2G27810		ATNAT12	ARABIDOPSIS NUCLEOBASE-ASCORBA...		Potri.009G148600 [exp]	9.69	0.7322
AT3G50860			Clathrin adaptor complex small...		Potri.007G025400 [exp]	16.55	0.7537
AT5G02960			Ribosomal protein S12/S23 fami...		Potri.010G217100 [exp]	27.92	0.6908	RPS23.2
AT2G22600			RNA-binding KH domain-containi...		Potri.007G012000 [exp]	31.17	0.7082
AT4G09550		ATGIP1	ARABIDOPSIS ATGCP3 INTERACTING...		Potri.006G035900 [exp]	35.49	0.6798
AT3G25580			Thioredoxin superfamily protei...		Potri.001G297900 [exp]	40.09	0.7011
AT4G34160		CYCD3;1	CYCLIN D3;1 (.1)		Potri.009G097800 [exp]	40.91	0.6442	CYCD3.2
AT1G26880			Ribosomal protein L34e superfa...		Potri.012G108400 [exp]	51.96	0.6967	RPL34.4
AT2G44740		CYCP4;1	cyclin p4;1 (.1)		Potri.014G050400 [exp]	62.13	0.6722
AT4G31750		WIN2	HOPW1-1-interacting 2 (.1)		Potri.006G267600 [exp]	66.82	0.6779

Compare expression of checked genes

Potri.019G091500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.