Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	RAB11.11
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G60860 419 / 2e-151 AtRABA1f RAB GTPase homolog A1F (.1) AT3G15060 402 / 6e-145 AtRABA1g RAB GTPase homolog A1G (.1) AT1G28550 387 / 5e-139 AtRABA1i RAB GTPase homolog A1I (.1) AT4G18430 385 / 3e-138 AtRABA1e RAB GTPase homolog A1E (.1) AT2G33870 381 / 2e-136 ArRABA1h RAB GTPase homolog A1H (.1) AT4G18800 358 / 2e-127 AthSGBP, AtRab11B, AtRABA1d RAB GTPase homolog A1D (.1) AT5G45750 357 / 7e-127 AtRABA1c RAB GTPase homolog A1C (.1) AT1G06400 342 / 7e-121 ARA2, AtRABA1a, AtRab11E, Ara-2 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) AT1G16920 340 / 3e-120 ATRABA4B, RAB11, ATRABA1B RAB GTPase homolog A1B (.1) AT1G09630 308 / 2e-107 ATRAB-A2A, ATRAB11C, ATRABA2A ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G123600 [exp] 432 / 1e-156 AT5G60860 419 / 2e-151 RAB GTPase homolog A1F (.1) Potri.001G374000 [exp] 409 / 1e-147 AT5G60860 417 / 1e-150 RAB GTPase homolog A1F (.1) Potri.011G061300 [exp] 405 / 4e-146 AT5G60860 416 / 5e-150 RAB GTPase homolog A1F (.1) Potri.011G070300 [exp] 356 / 2e-126 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.004G061000 [exp] 354 / 7e-126 AT4G18800 392 / 9e-141 RAB GTPase homolog A1D (.1) Potri.003G004100 [exp] 310 / 3e-108 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1) Potri.010G197200 [exp] 299 / 4e-104 AT1G07410 370 / 3e-132 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.006G000300 [exp] 299 / 6e-104 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.008G061300 [exp] 297 / 2e-103 AT1G07410 367 / 9e-131 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017679 [exp] 429 / 3e-155 AT5G60860 426 / 4e-154 RAB GTPase homolog A1F (.1) Lus10002178 [exp] 429 / 3e-155 AT5G60860 423 / 4e-153 RAB GTPase homolog A1F (.1) Lus10015297 [exp] 416 / 3e-150 AT5G60860 428 / 6e-155 RAB GTPase homolog A1F (.1) Lus10025432 [exp] 411 / 2e-148 AT5G60860 422 / 1e-152 RAB GTPase homolog A1F (.1) Lus10013961 [exp] 404 / 3e-145 AT5G60860 412 / 7e-149 RAB GTPase homolog A1F (.1) Lus10039895 [exp] 401 / 1e-144 AT5G60860 397 / 5e-143 RAB GTPase homolog A1F (.1) Lus10029253 [exp] 360 / 6e-128 AT5G45750 393 / 4e-141 RAB GTPase homolog A1C (.1) Lus10007306 [exp] 357 / 5e-127 AT5G45750 387 / 5e-139 RAB GTPase homolog A1C (.1) Lus10020746 [exp] 328 / 3e-115 AT1G06400 375 / 3e-134 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1) Lus10029789 [exp] 327 / 3e-115 AT1G06400 373 / 3e-133 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A1A, Ras-related small GTP-binding family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [poplar] [flax] P-loop_NTPase PF00025 [poplar] [flax] Arf ADP-ribosylation factor family
Representative CDS sequence Show only first row Show all	>Potri.019G092500.1 pacid=42773898 polypeptide=Potri.019G092500.1.p locus=Potri.019G092500 ID=Potri.019G092500.1.v4.1 annot-version=v4.1 ATGGGTGCTTACAGGGCAGATGATGACTATGATTATCTATTCAAGTTAGTGTTGATAGGTGATTCTGGTGTTGGAAAATCCAATCTTTTATCAAGATTTA CAAGGAATGAATTCAGTTTGGAATCCAAATCCACTATTGGAGTTGAATTTGCCACTCGTAGTATCCATGTTGATGATAAAGTTGTCAAAGCTCAGATTTG GGACACTGCTGGCCAAGAAAGATACCGTGCAATTACTAGTGCATATTATCGAGGAGCTGTTGGCGCCTTGCTTGTCTATGATGTCACTCGACATGTCACT TTTGAGAATGTGGAGAGATGGCTAAAGGAACTTCGTGATCACACTGATTCAAACATTGTGATTATGCTTGTGGGAAACAAAGCAGATTTGCGTCACTTGC GTGCAGTTACTACTGAGGATGCCACTGCATTTGCTGAGAGAGAAAATACTTTTTTCATGGAGACCTCTGCCCTAGAGTCCTTGAATGTTGAAAATGCTTT CACTGAAGTGCTCACTCAGATTCATCGTGTAGTCAGCCGGAAGGCTCTTGATGTTGGGGATGATCCTGCAGCCTTGCCCAAGGGACAGACTATTACTGTC GGCAAAGATGATGTATCAGCTGTGAAAAAGGTTGGATGCTGCTCCGCATAG
AA sequence Show only first row Show all	>Potri.019G092500.1 pacid=42773898 polypeptide=Potri.019G092500.1.p locus=Potri.019G092500 ID=Potri.019G092500.1.v4.1 annot-version=v4.1 MGAYRADDDYDYLFKLVLIGDSGVGKSNLLSRFTRNEFSLESKSTIGVEFATRSIHVDDKVVKAQIWDTAGQERYRAITSAYYRGAVGALLVYDVTRHVT FENVERWLKELRDHTDSNIVIMLVGNKADLRHLRAVTTEDATAFAERENTFFMETSALESLNVENAFTEVLTQIHRVVSRKALDVGDDPAALPKGQTITV GKDDVSAVKKVGCCSA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Potri.019G092500 [exp]	0	1	RAB11.11
AT5G60860		AtRABA1f	RAB GTPase homolog A1F (.1)		Potri.013G123600 [exp]	1.41	0.9667	Pt-RAB11.8
AT3G12110		ACT11	actin-11 (.1)		Potri.010G204300 [exp]	3.46	0.9549	ACT5,Pt-PEAC14.3
AT1G01050		ATPPA1	pyrophosphorylase 1 (.1)		Potri.002G181300 [exp]	3.46	0.9466
AT2G18990		TXND9	thioredoxin domain-containing ...		Potri.009G092700 [exp]	4.00	0.9436
AT1G30440			Phototropic-responsive NPH3 fa...		Potri.011G091100 [exp]	4.12	0.9353
AT4G16450			unknown protein		Potri.006G016300 [exp]	4.47	0.9472
AT5G56540		ATAGP14, AGP14	arabinogalactan protein 14 (.1...		Potri.013G057500 [exp]	6.63	0.9409
AT2G16595			Translocon-associated protein ...		Potri.004G168500 [exp]	6.63	0.9476
AT1G10630		ATARFA1F	ADP-ribosylation factor A1F (....		Potri.014G116500 [exp]	6.92	0.9486	Pt-ARF1.1
AT2G33040		ATP3	gamma subunit of Mt ATP syntha...		Potri.012G066100 [exp]	10.39	0.9338	ATPC.1

Compare expression of checked genes

Potri.019G092500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.