Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35160 78 / 4e-18 O-methyltransferase family protein (.1) AT1G51990 76 / 2e-17 O-methyltransferase family protein (.1.2) AT4G35150 75 / 4e-17 O-methyltransferase family protein (.1) AT1G33030 65 / 2e-13 O-methyltransferase family protein (.1) AT1G21130 64 / 4e-13 IGMT4 indole glucosinolate O-methyltransferase 4, O-methyltransferase family protein (.1.2) AT1G21100 64 / 4e-13 IGMT1 indole glucosinolate O-methyltransferase 1, O-methyltransferase family protein (.1) AT5G53810 64 / 5e-13 O-methyltransferase family protein (.1) AT1G21110 63 / 8e-13 IGMT3 indole glucosinolate O-methyltransferase 3, O-methyltransferase family protein (.1) AT1G77520 63 / 1e-12 O-methyltransferase family protein (.1) AT1G77530 61 / 5e-12 O-methyltransferase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G093000 [exp] 205 / 7e-67 AT4G35160 230 / 1e-72 O-methyltransferase family protein (.1) Potri.019G093100 [exp] 177 / 4e-56 AT4G35160 225 / 1e-70 O-methyltransferase family protein (.1) Potri.013G121400 [exp] 144 / 3e-43 AT4G35160 202 / 8e-62 O-methyltransferase family protein (.1) Potri.013G121900 [exp] 144 / 5e-43 AT4G35160 184 / 5e-55 O-methyltransferase family protein (.1) Potri.013G122400 [exp] 144 / 6e-43 AT4G35160 188 / 2e-56 O-methyltransferase family protein (.1) Potri.013G120800 [exp] 143 / 1e-42 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1) Potri.013G121800 [exp] 139 / 6e-42 AT4G35160 158 / 7e-46 O-methyltransferase family protein (.1) Potri.013G122100 [exp] 133 / 1e-41 AT4G35160 65 / 2e-13 O-methyltransferase family protein (.1) Potri.013G121300 [exp] 140 / 2e-41 AT4G35160 201 / 4e-61 O-methyltransferase family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033656 [exp] 182 / 1e-57 AT4G35150 211 / 8e-65 O-methyltransferase family protein (.1) Lus10017699 [exp] 176 / 4e-55 AT4G35150 204 / 2e-62 O-methyltransferase family protein (.1) Lus10015311 [exp] 130 / 9e-38 AT4G35160 189 / 1e-56 O-methyltransferase family protein (.1) Lus10018628 [exp] 127 / 2e-36 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1) Lus10025440 [exp] 117 / 1e-35 AT4G35150 68 / 9e-15 O-methyltransferase family protein (.1) Lus10008538 [exp] 119 / 1e-33 AT4G35160 167 / 5e-48 O-methyltransferase family protein (.1) Lus10017695 [exp] 115 / 4e-33 AT4G35150 140 / 6e-40 O-methyltransferase family protein (.1) Lus10018629 [exp] 115 / 3e-32 AT4G35160 214 / 3e-66 O-methyltransferase family protein (.1) Lus10013945 [exp] 114 / 1e-31 AT4G35160 181 / 1e-53 O-methyltransferase family protein (.1) Lus10017691 [exp] 114 / 2e-31 AT4G35160 194 / 2e-58 O-methyltransferase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0063 [poplar] [flax] NADP_Rossmann PF00891 [poplar] [flax] Methyltransf_2 O-methyltransferase domain
Representative CDS sequence Show only first row Show all	>Potri.019G093200.2 pacid=42773200 polypeptide=Potri.019G093202.1.p locus=Potri.019G093200 ID=Potri.019G093200.2.v4.1 annot-version=v4.1 ATGCCAAGCAGAGCAACTTGGACGTGGTCGTTATCTCCAGCCAAATGGATTCTACATGACTGGAATGATGAAGAATGTGTTAAGATACTTAAGAAATGCA AGGAAGCAATCAAGGACAGGGAAGGAGGGAAGGTGATGATCATAGACATGATGATGGAGAACCAGAAAGGAGAAGACGAATCAATTGAAACACAAATATT CTTCGATATGCTCATGATGATTCTGGTCACTGGCCAAGAAAGAAATGAGAAAGAATGGGCTAAACTATTCTCTGATGCTGGTTTTAGTAACTACAAGATA ACTCCCATACTGGGTTTAAGGTCTATCATTGAAGTGTTCCCTTGA
AA sequence Show only first row Show all	>Potri.019G093200.2 pacid=42773200 polypeptide=Potri.019G093202.1.p locus=Potri.019G093200 ID=Potri.019G093200.2.v4.1 annot-version=v4.1 MPSRATWTWSLSPAKWILHDWNDEECVKILKKCKEAIKDREGGKVMIIDMMMENQKGEDESIETQIFFDMLMMILVTGQERNEKEWAKLFSDAGFSNYKI TPILGLRSIIEVFP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G35160			O-methyltransferase family pro...		Potri.019G093200 [exp]	0	1
AT4G13440			Calcium-binding EF-hand family...		Potri.019G026860 [exp]	2.44	0.9391
AT3G55646			unknown protein		Potri.008G061700 [exp]	5.83	0.9380
AT5G06860		ATPGIP1, PGIP1	polygalacturonase inhibiting p...		Potri.006G058500 [exp]	6.00	0.9299
AT5G07440		GDH2	glutamate dehydrogenase 2 (.1....		Potri.015G111000 [exp]	10.95	0.9088
AT1G10010		AAP8, ATAAP8	amino acid permease 8 (.1)		Potri.006G236000 [exp]	16.24	0.9234
AT4G38470		STY46	serine/threonine/tyrosine kina...		Potri.004G179514 [exp]	19.07	0.9267
AT4G18250			receptor serine/threonine kina...		Potri.017G009600 [exp]	21.63	0.9254
AT5G36930			Disease resistance protein (TI...		Potri.019G001602 [exp]	26.83	0.9289
AT1G65810			P-loop containing nucleoside t...		Potri.004G077500 [exp]	29.66	0.8967
AT1G29670			GDSL-like Lipase/Acylhydrolase...		Potri.012G137550 [exp]	30.19	0.8907

Compare expression of checked genes

Potri.019G093200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.