Potri.019G093800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G54420 369 / 8e-130 ATCHITIV, CHIV, ATEP3 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
AT2G43590 323 / 4e-112 Chitinase family protein (.1)
AT2G43580 296 / 3e-101 Chitinase family protein (.1)
AT2G43570 268 / 3e-90 CHI "chitinase, putative", chitinase, putative (.1)
AT2G43620 251 / 2e-83 Chitinase family protein (.1)
AT2G43610 249 / 1e-82 Chitinase family protein (.1)
AT3G47540 217 / 8e-71 Chitinase family protein (.1.2)
AT1G56680 193 / 2e-60 Chitinase family protein (.1)
AT2G43600 174 / 4e-53 Chitinase family protein (.1)
AT3G12500 167 / 8e-50 PR-3, PR3, CHI-B, B-CHI, ATHCHIB PATHOGENESIS-RELATED 3, basic chitinase (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G125000 395 / 4e-140 AT3G54420 421 / 1e-150 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G093700 389 / 6e-138 AT3G54420 413 / 3e-147 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G093900 387 / 9e-137 AT3G54420 360 / 3e-126 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G094100 384 / 1e-135 AT3G54420 350 / 3e-122 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.013G125100 379 / 5e-134 AT3G54420 336 / 1e-116 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.019G094000 365 / 2e-128 AT3G54420 340 / 2e-118 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Potri.004G182000 178 / 3e-54 AT3G12500 460 / 5e-164 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.009G141700 177 / 5e-54 AT3G12500 405 / 3e-142 PATHOGENESIS-RELATED 3, basic chitinase (.1)
Potri.014G111800 163 / 8e-49 AT4G01700 422 / 1e-150 Chitinase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000453 345 / 2e-120 AT3G54420 382 / 3e-135 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10003231 254 / 2e-85 AT3G54420 241 / 2e-80 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10003226 256 / 2e-84 AT3G54420 269 / 2e-89 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10024368 252 / 2e-84 AT2G43590 264 / 2e-89 Chitinase family protein (.1)
Lus10003587 250 / 2e-83 AT2G43590 270 / 1e-91 Chitinase family protein (.1)
Lus10010861 249 / 4e-83 AT2G43590 263 / 6e-89 Chitinase family protein (.1)
Lus10010862 249 / 6e-83 AT2G43590 262 / 1e-88 Chitinase family protein (.1)
Lus10032794 246 / 5e-82 AT2G43590 265 / 6e-90 Chitinase family protein (.1)
Lus10035625 246 / 4e-81 AT3G54420 266 / 7e-89 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
Lus10010866 242 / 2e-80 AT3G54420 239 / 1e-79 CHITINASE CLASS IV, homolog of carrot EP3-3 chitinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0037 Lysozyme PF00182 Glyco_hydro_19 Chitinase class I
CL0037 PF00187 Chitin_bind_1 Chitin recognition protein
Representative CDS sequence
>Potri.019G093800.1 pacid=42773368 polypeptide=Potri.019G093800.1.p locus=Potri.019G093800 ID=Potri.019G093800.1.v4.1 annot-version=v4.1
ATGTTTTCTCTTAACATGGGAAACAATTTACTATCCATCATTCTGGCTATGATGCTGGCTGTAACCATGCCACAGTTGCTAATGTCTCAAAATTGTGGTT
GTGCTCCCAACTTGTGCTGTAGTCAGTTTGGCTTCTGTGGCACCGGTGATGCTTATTGTGGCCAAGGATGTCGAGAGGGACCTTGTACCCCTAGCACGCC
TAGTAACAATGATGTTACGGTGGCTGACGTTGTTACACCGGAATTCTTCAACGGTATAATCAATCAAGCCGGTGGAGATTGTGCCGGGAAGAGCTTCTAC
ACACGAGATGCGTTTCTCAGTGCTCTCAATTCTTATTCTCAGTTTGGCAAGATTGGATCAAATGACGATTCCAAACGTGAGATTGCAGCATTTTTTGCTC
ACGTCACGCATGAGACCGGACACTTCTGCTACATAGAAGAAATAAACGGTGCCTCTCATGACTACTGTGATGAGACCAATACACAGTATCCATGCAACCC
GAACAAGAACTACTTTGGCCGTGGACCTCTTCAACTAACATGGAATTACAATTACGGGGCGGCTGGAGGGGCAAACAACTTTGATGGACTAAACTCTCCC
GAAACTGTGGCCAATGATCCTGTTGTATCATTTAAGACTGCCTTATGGTTTTGGATGACTAATGTCCGCCCTGTGGTCACTCAAGGATTTGGTGCAACGA
TTAGAGCCATTAATGGTGCAGTTGAATGTAATGGTGGAAATTCTGGTGCTGTTCAAGCTCGAATTGGGTATTACACAGATTATTGTAACCAGTTTGGCGT
TGCACCTGGCGATAATCTAAGTTGTTAG
AA sequence
>Potri.019G093800.1 pacid=42773368 polypeptide=Potri.019G093800.1.p locus=Potri.019G093800 ID=Potri.019G093800.1.v4.1 annot-version=v4.1
MFSLNMGNNLLSIILAMMLAVTMPQLLMSQNCGCAPNLCCSQFGFCGTGDAYCGQGCREGPCTPSTPSNNDVTVADVVTPEFFNGIINQAGGDCAGKSFY
TRDAFLSALNSYSQFGKIGSNDDSKREIAAFFAHVTHETGHFCYIEEINGASHDYCDETNTQYPCNPNKNYFGRGPLQLTWNYNYGAAGGANNFDGLNSP
ETVANDPVVSFKTALWFWMTNVRPVVTQGFGATIRAINGAVECNGGNSGAVQARIGYYTDYCNQFGVAPGDNLSC

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G54420 ATCHITIV, CHIV,... CHITINASE CLASS IV, homolog of... Potri.019G093800 0 1
AT3G04120 GAPC1, GAPC-1, ... glyceraldehyde-3-phosphate deh... Potri.008G179300 1.00 0.9879 GAPDH.1
AT5G24090 ATCHIA chitinase A (.1) Potri.012G033866 3.46 0.9700
Potri.008G163200 6.48 0.9661
AT1G73260 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TR... Potri.007G111600 8.00 0.9651
AT3G19615 unknown protein Potri.001G294800 12.40 0.9592
AT5G46940 Plant invertase/pectin methyle... Potri.003G086500 19.07 0.9711
AT1G17860 Kunitz family trypsin and prot... Potri.001G309900 24.89 0.9691
AT1G73260 ATKTI1 ARABIDOPSIS THALIANA KUNITZ TR... Potri.004G000400 34.89 0.9665
Potri.001G268500 40.76 0.9119
AT4G19810 ChiC class V chitinase, Glycosyl hy... Potri.006G188400 43.47 0.9639

Potri.019G093800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.