Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46470 172 / 9e-49 RPS6 RESISTANT TO P. SYRINGAE 6, disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G17680 160 / 1e-44 disease resistance protein (TIR-NBS-LRR class), putative (.1) AT5G46450 159 / 3e-44 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G40060 158 / 5e-44 Disease resistance protein (NBS-LRR class) family (.1) AT4G08450 156 / 2e-43 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G46270 150 / 5e-41 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63880 149 / 1e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G51630 148 / 2e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2), Disease resistance protein (TIR-NBS-LRR class) family (.3) AT5G22690 147 / 4e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G14370 145 / 2e-39 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G097800 [exp] 368 / 1e-119 AT5G17680 512 / 3e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G098700 [exp] 360 / 5e-119 AT5G17680 379 / 3e-114 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G098900 [exp] 342 / 4e-110 AT5G17680 477 / 6e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G098500 [exp] 331 / 1e-107 AT5G17680 496 / 4e-157 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G113701 [exp] 332 / 2e-105 AT5G17680 596 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G097100 [exp] 325 / 1e-103 AT4G12010 521 / 8e-165 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G095866 [exp] 220 / 8e-70 AT3G44480 182 / 3e-50 recognition of peronospora parasitica 1, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.017G010800 [exp] 229 / 1e-68 AT5G17680 592 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G068200 [exp] 219 / 4e-65 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000121 [exp] 171 / 3e-50 AT5G17680 277 / 1e-82 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041078 [exp] 174 / 7e-50 AT5G17680 399 / 6e-126 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 171 / 2e-48 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10026201 [exp] 171 / 3e-48 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10042465 [exp] 160 / 6e-47 AT5G46490 151 / 3e-40 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10030345 [exp] 162 / 3e-45 AT5G17680 528 / 5e-168 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10041060 [exp] 162 / 3e-45 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10016029 [exp] 159 / 2e-44 AT4G12010 451 / 2e-138 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10015350 [exp] 155 / 8e-43 AT4G12010 422 / 2e-127 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10004075 [exp] 153 / 4e-42 AT4G12010 348 / 3e-102 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [poplar] [flax] LRR PF07725 [poplar] [flax] LRR_3 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Potri.019G097640.1 pacid=42773714 polypeptide=Potri.019G097640.1.p locus=Potri.019G097640 ID=Potri.019G097640.1.v4.1 annot-version=v4.1 ATGCTAGAAATGCATGATTTACTACAAGAAATGGCATTTAACATTGTCCGTGCAGAATCTGATTTTCCTGGCGAACATAGCAGGTTATGTCGTCTTCCTG ATGTCGTTCATGTATTGGAGGAAAATAAGGGAACTCAAAAAATTAAAGGCATGTCTTTGGACATGTCCATGTTATCAAGACATATACACTTGAAATCTGA TGCCTTCGCAATGATGGATGGTCTTAGATTTCTCAATTTCTATCACGATGGTATCTCCAAAGAAAATATAGTGCACCTTCCTCCTACTGGCCTCGAATAT CTTCCTAATGAGCTGAGATATTTGCGATGGTATGGATTCCCTTCGAAATCCTTGCCGCCATCTTTTCGTGTTGAACACCTTGTCGAGCTTGACCTATGCG GAAGCAAGCTTGTAAAACTTTGGACTGGAGTAAAGGATGTTGGAAATTTAAGAAAAATTACCCTATCTTACTCTCCATATTTGACAGAATTGCCAGATCT ATCAAAGGCCAAAAATTTAGAGTGCTTACAACTTGTGGCCTGTTATAGTTTAACTGAGGTTCCGTCATCTCTTCAATATCTTGACAAGCTGGAAGAACTT GATGTCCATTTTTGCTATAATCTTAGAAGTTTTCCAATGCTTGATTCAAAGGTTCTTAAGAAAAATTACCCTATCTTACTCTCCATATTTGACAGAATTG CCAGATCTATCAAAGGCCAAAAATTTAGAGTGCTTACAACTTGTGGCCTGTTATAG
AA sequence Show only first row Show all	>Potri.019G097640.1 pacid=42773714 polypeptide=Potri.019G097640.1.p locus=Potri.019G097640 ID=Potri.019G097640.1.v4.1 annot-version=v4.1 MLEMHDLLQEMAFNIVRAESDFPGEHSRLCRLPDVVHVLEENKGTQKIKGMSLDMSMLSRHIHLKSDAFAMMDGLRFLNFYHDGISKENIVHLPPTGLEY LPNELRYLRWYGFPSKSLPPSFRVEHLVELDLCGSKLVKLWTGVKDVGNLRKITLSYSPYLTELPDLSKAKNLECLQLVACYSLTEVPSSLQYLDKLEEL DVHFCYNLRSFPMLDSKVLKKNYPILLSIFDRIARSIKGQKFRVLTTCGLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G46470		RPS6	RESISTANT TO P. SYRINGAE 6, di...		Potri.019G097640 [exp]	0	1
AT5G17680			disease resistance protein (TI...		Potri.019G098700 [exp]	3.46	0.9661
AT2G34930			disease resistance family prot...		Potri.001G043800 [exp]	4.12	0.8811
AT2G01570	GRAS	RGA1	REPRESSOR OF GA1-3 1, REPRESSO...		Potri.017G148266 [exp]	5.29	0.9240
AT1G63860			Disease resistance protein (TI...		Potri.019G097720 [exp]	5.91	0.9355
AT5G38280		PR5K	PR5-like receptor kinase (.1)		Potri.015G122000 [exp]	8.94	0.8695
AT1G07650			Leucine-rich repeat transmembr...		Potri.004G135500 [exp]	9.74	0.7525
AT5G17680			disease resistance protein (TI...		Potri.019G097800 [exp]	9.94	0.8980
AT5G17680			disease resistance protein (TI...		Potri.019G098900 [exp]	10.39	0.9012
AT5G22380	NAC	ANAC090	NAC domain containing protein ...		Potri.016G076000 [exp]	12.24	0.8554
AT5G17680			disease resistance protein (TI...		Potri.019G098500 [exp]	13.96	0.8858

Compare expression of checked genes

Potri.019G097640 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.