Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G59780 149 / 5e-43 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G095833 [exp] 206 / 4e-70 AT3G59780 153 / 2e-44 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.013G128300 [exp] 208 / 5e-65 AT3G59780 610 / 0.0 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Potri.019G098950 [exp] 120 / 4e-35 AT3G59780 95 / 2e-22 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027050 [exp] 145 / 3e-42 AT3G59780 562 / 0.0 Rhodanese/Cell cycle control phosphatase superfamily protein (.1) Lus10025587 [exp] 108 / 2e-28 AT3G59780 510 / 5e-173 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G097901.1 pacid=42774385 polypeptide=Potri.019G097901.1.p locus=Potri.019G097901 ID=Potri.019G097901.1.v4.1 annot-version=v4.1 ATGACGGGTTTTGCTGCAGCATCATATGCATTGCTAGAGTGGGAGAAGACCTTACAATTTATTGCCATCATTGGCCTCAGTCAGACTATTTATCAGCGGG TTGCTTCTTACAATGGCCCTGAAGATTTTAAGCAAGATGTGTGTTTTCTCTCTCCTGTTAGACTTGGAGTCCAGGCATTTTCATGGGCAGCAGGAAAACT GGAAAACAACCGCATTGGTTTACCTACATCACCTTCATCTTCAGATGTTCAAAACCGGGTGCTGCAAGCTGCTGCAAAGCATGAATCCCAAACATCTAAA ACTGAAGTTCCGAATCCATCACCTGAATCAGTGACTCCATTAAATGAGAAAGTAGATCTTTCAGAAGCATAG
AA sequence Show only first row Show all	>Potri.019G097901.1 pacid=42774385 polypeptide=Potri.019G097901.1.p locus=Potri.019G097901 ID=Potri.019G097901.1.v4.1 annot-version=v4.1 MTGFAAASYALLEWEKTLQFIAIIGLSQTIYQRVASYNGPEDFKQDVCFLSPVRLGVQAFSWAAGKLENNRIGLPTSPSSSDVQNRVLQAAAKHESQTSK TEVPNPSPESVTPLNEKVDLSEA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G59780			Rhodanese/Cell cycle control p...		Potri.019G097901 [exp]	0	1
AT3G59780			Rhodanese/Cell cycle control p...		Potri.019G098001 [exp]	3.16	0.8190
AT3G14172			unknown protein		Potri.013G091900 [exp]	9.38	0.6951
AT3G45740			hydrolase family protein / HAD...		Potri.010G216000 [exp]	20.00	0.7477
AT1G08980		ATTOC64-I, ATAM...	ARABIDOPSIS THALIANA TRANSLOCO...		Potri.013G024200 [exp]	23.36	0.7410
AT1G68890			magnesium ion binding;thiamin ...		Potri.010G135500 [exp]	26.83	0.7023
AT3G48110		EDD1	EMBRYO-DEFECTIVE-DEVELOPMENT 1...		Potri.014G049200 [exp]	33.13	0.7030
AT2G34090		MEE18	maternal effect embryo arrest ...		Potri.011G065000 [exp]	35.70	0.5785
AT2G32640			Lycopene beta/epsilon cyclase ...		Potri.014G156800 [exp]	48.24	0.6501
AT2G20830			transferases;folic acid bindin...		Potri.013G145700 [exp]	52.15	0.6690
AT3G11620		BAS1	alpha/beta-Hydrolases superfam...		Potri.016G072700 [exp]	53.70	0.6391

Compare expression of checked genes

Potri.019G097901 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.