Potri.019G098001 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G59780 92 / 7e-21 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G128300 337 / 2e-112 AT3G59780 610 / 0.0 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.014G182410 95 / 4e-24 AT3G59780 126 / 2e-34 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Potri.019G098950 40 / 0.0008 AT3G59780 95 / 2e-22 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025587 92 / 4e-21 AT3G59780 510 / 5e-173 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10027050 52 / 1e-07 AT3G59780 562 / 0.0 Rhodanese/Cell cycle control phosphatase superfamily protein (.1)
Lus10001465 41 / 0.0007 AT1G55020 1162 / 0.0 ARABIDOPSIS LIPOXYGENASE 1, lipoxygenase 1 (.1)
PFAM info
Representative CDS sequence
>Potri.019G098001.1 pacid=42774398 polypeptide=Potri.019G098001.1.p locus=Potri.019G098001 ID=Potri.019G098001.1.v4.1 annot-version=v4.1
ATGTTGCCTGTTTGCTCTGCCACTCAGTGTTGTTCCTCTCATTCTCAGATAACATTCCATGGAGGTCTGCAACCATTTTGCTCAGTCTGGAAGGATTTCG
AGTCCAGATGTTATGTTGTAGACATGGTACTTTTGGGAATGTCAAATATAACACATCACCAAAGAATTTCCTTCAAAACACAAGCTATAAAGTCTTTCTA
CTCCAATTTTATTGAAAGCTTTGCTTTCATTAATGATCATTCTTGCCCAAATGAACTAGGCAACATTAATTGCAACTTTTATAAGGATTGCGATTCTTCA
GTTGGAGCAATAGATGAACTGCACCCACACCCTATGGGAGGGGGTAAACTGAAATTCTTAGAAAGTTATAACATATCTGATGTTGAAGAAGGACCTTTGA
ACTCTGCAGACCAGTTTGCTGATAATACAGATAGTTTAATACGACTTGTGGAACCTGAAATAACATCAACTATTGATATGACACCAGTGAATCCCAGTTT
GGGATCTGATTCCCTGGAAATGGATAACGATTCATTATCTAGTGCAAAGGCTGGTTTTAATGATTTTTTGGGCGAGGTTAGGGACTCCATCAACACTTCA
GTAAATAATGGAGGAAATGTTGTGCAAAGCTCACTAGACACAATTACTTCTTCAATAACATCAATTAAGGAAGGTGCTTCAGAAGCAGTAGATGGTGCCT
TGAGTAAAGTTTTCTCTACTTTTGATCAAACAGAAGAATTAGCTGCCAAAGACTGA
AA sequence
>Potri.019G098001.1 pacid=42774398 polypeptide=Potri.019G098001.1.p locus=Potri.019G098001 ID=Potri.019G098001.1.v4.1 annot-version=v4.1
MLPVCSATQCCSSHSQITFHGGLQPFCSVWKDFESRCYVVDMVLLGMSNITHHQRISFKTQAIKSFYSNFIESFAFINDHSCPNELGNINCNFYKDCDSS
VGAIDELHPHPMGGGKLKFLESYNISDVEEGPLNSADQFADNTDSLIRLVEPEITSTIDMTPVNPSLGSDSLEMDNDSLSSAKAGFNDFLGEVRDSINTS
VNNGGNVVQSSLDTITSSITSIKEGASEAVDGALSKVFSTFDQTEELAAKD

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G59780 Rhodanese/Cell cycle control p... Potri.019G098001 0 1
AT3G59780 Rhodanese/Cell cycle control p... Potri.019G097901 3.16 0.8190
AT1G68890 magnesium ion binding;thiamin ... Potri.010G135500 3.46 0.8315
AT3G48110 EDD1 EMBRYO-DEFECTIVE-DEVELOPMENT 1... Potri.014G049200 8.36 0.8182
AT1G25570 Di-glucose binding protein wit... Potri.010G129300 10.58 0.7228
AT3G14172 unknown protein Potri.013G091900 12.04 0.7228
AT5G49760 Leucine-rich repeat protein ki... Potri.003G046450 12.72 0.8184
AT3G45740 hydrolase family protein / HAD... Potri.010G216000 23.66 0.7680
AT2G41720 EMB2654 EMBRYO DEFECTIVE 2654, Tetratr... Potri.006G049900 30.29 0.7245
AT4G18240 ATSS4, SSIV ARABIDOPSIS THALIANA STARCH SY... Potri.018G149500 33.67 0.6994
AT4G31780 UGT81A1, EMB279... UDP-glycosyl transferase 81A1,... Potri.018G016600 35.49 0.7494

Potri.019G098001 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.