Potri.019G098550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45230 54 / 2e-08 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT5G17880 49 / 1e-06 CSA1 constitutive shade-avoidance1, disease resistance protein (TIR-NBS-LRR class) (.1)
AT3G51570 46 / 9e-06 Disease resistance protein (TIR-NBS-LRR class) family (.1)
AT4G36150 41 / 0.0003 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G097100 395 / 3e-131 AT4G12010 521 / 8e-165 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Potri.019G097720 273 / 1e-92 AT1G63860 79 / 3e-16 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Potri.019G098900 272 / 3e-85 AT5G17680 477 / 6e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G097800 270 / 3e-84 AT5G17680 512 / 3e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G098700 261 / 5e-82 AT5G17680 379 / 3e-114 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G113701 199 / 7e-59 AT5G17680 596 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.017G010800 128 / 3e-34 AT5G17680 592 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G068200 108 / 3e-27 AT5G17680 629 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Potri.019G068300 98 / 1e-23 AT5G17680 580 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10016029 72 / 1e-14 AT4G12010 451 / 2e-138 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10015350 66 / 1e-12 AT4G12010 422 / 2e-127 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10012247 54 / 1e-08 AT5G45230 92 / 2e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Lus10005171 44 / 4e-05 AT1G27170 576 / 0.0 transmembrane receptors;ATP binding (.1.2)
Lus10011104 44 / 7e-05 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10005588 43 / 8e-05 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10026201 41 / 0.0006 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Lus10028043 40 / 0.0006 AT5G17680 59 / 4e-09 disease resistance protein (TIR-NBS-LRR class), putative (.1)
PFAM info
Representative CDS sequence
>Potri.019G098550.1 pacid=42773686 polypeptide=Potri.019G098550.1.p locus=Potri.019G098550 ID=Potri.019G098550.1.v4.1 annot-version=v4.1
ATGCATTTGAAAATTCAGTCCGGAGATAAGATCCCATATGACAGAATTCAAATGGTTCTACCGGGGAGTGAAATTCCAGAATGGTTCAGTGACAAAGGAA
TTGGATCTTCACTCACCATACAGTTGCCCACAAATTGTCATCAGCTCAAGGGAATTGCTTTCTGCCTTGTCTTTCTACTCCCTCTTCCCTCCCATGAGAT
GCTTTATGAATTCGATGATCATCCTGAAGTTCGCGTATATTTTGATTGCCATGTTAAGAGTAAAAAGGGTGAGCATGATGGTGATGATGAAGAAGTCTTC
GTTTCCAAGAAAAGCTATAGTATATTCAATTTCTTGAAGACATGTGACTCAGATCACATGTTTCTACACTATGAGCTCGAATTAGTAAATCATTTCCGTA
AATATTCTGGCAATGAAGTTACATGTAAATTCTACCATGAAGTGGACAACGGGAGTACGAAAGTAGGTCATGAGATTCGAAAGCCTTGCGAGTTGAAAAG
CTGTGGTGTATATCTGCACTTTGATGAAAATCTACAGGCCGGCACTTTGTTAAGGATCTTCCTTAACAAACAAAAGTTTAGAAGAAAATTGAGGGAGAAA
TAG
AA sequence
>Potri.019G098550.1 pacid=42773686 polypeptide=Potri.019G098550.1.p locus=Potri.019G098550 ID=Potri.019G098550.1.v4.1 annot-version=v4.1
MHLKIQSGDKIPYDRIQMVLPGSEIPEWFSDKGIGSSLTIQLPTNCHQLKGIAFCLVFLLPLPSHEMLYEFDDHPEVRVYFDCHVKSKKGEHDGDDEEVF
VSKKSYSIFNFLKTCDSDHMFLHYELELVNHFRKYSGNEVTCKFYHEVDNGSTKVGHEIRKPCELKSCGVYLHFDENLQAGTLLRIFLNKQKFRRKLREK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G45230 Disease resistance protein (TI... Potri.019G098550 0 1
AT4G27220 NB-ARC domain-containing disea... Potri.019G023300 5.00 0.9069
AT5G36930 Disease resistance protein (TI... Potri.019G018396 10.19 0.8638
AT5G36930 Disease resistance protein (TI... Potri.019G021681 11.57 0.8735
AT5G36930 Disease resistance protein (TI... Potri.019G017082 12.84 0.8722
AT3G49490 unknown protein Potri.002G230100 16.24 0.7856
Potri.010G142250 19.79 0.7914
AT5G36930 Disease resistance protein (TI... Potri.011G015400 21.97 0.8484
AT4G16580 Protein phosphatase 2C family ... Potri.011G013000 23.23 0.8207
AT3G14470 NB-ARC domain-containing disea... Potri.017G127651 24.49 0.8412
AT2G01570 GRAS RGA1 REPRESSOR OF GA1-3 1, REPRESSO... Potri.017G148266 25.80 0.8327

Potri.019G098550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.