Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20142 139 / 3e-40 Toll-Interleukin-Resistance (TIR) domain family protein (.1) AT4G16860 142 / 2e-39 RPP5, RPP4 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16950 140 / 2e-38 RPP5 RECOGNITION OF PERONOSPORA PARASITICA 5, Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT4G16960 139 / 3e-38 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16990 136 / 2e-37 RLM3 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative AT4G16900 136 / 4e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G16920 135 / 6e-37 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT4G11170 134 / 2e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G17600 133 / 4e-36 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G72920 127 / 4e-36 Toll-Interleukin-Resistance (TIR) domain family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G098900 [exp] 316 / 1e-101 AT5G17680 477 / 6e-148 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G098800 [exp] 291 / 3e-98 AT4G16860 255 / 3e-75 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G097300 [exp] 290 / 4e-97 AT4G16860 272 / 8e-81 recognition of peronospora parasitica 4, Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G095932 [exp] 284 / 5e-94 AT4G11170 294 / 5e-88 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G098500 [exp] 292 / 9e-94 AT5G17680 496 / 4e-157 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G097100 [exp] 293 / 5e-93 AT4G12010 521 / 8e-165 Disease resistance protein (TIR-NBS-LRR class) family (.1) Potri.019G097800 [exp] 282 / 9e-89 AT5G17680 512 / 3e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G113701 [exp] 276 / 2e-86 AT5G17680 596 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.019G097580 [exp] 244 / 9e-80 AT4G11170 244 / 8e-72 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042752 [exp] 163 / 2e-51 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10029722 [exp] 161 / 6e-46 AT5G17680 608 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10013729 [exp] 150 / 2e-42 AT5G36930 310 / 2e-92 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10026201 [exp] 146 / 1e-40 AT5G17680 511 / 1e-160 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10005588 [exp] 142 / 4e-39 AT5G17680 499 / 2e-156 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10014582 [exp] 135 / 4e-39 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10014829 [exp] 140 / 1e-38 AT5G17680 441 / 1e-136 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10015453 [exp] 135 / 9e-38 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10032101 [exp] 134 / 5e-37 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10007030 [exp] 135 / 8e-37 AT4G12010 316 / 3e-94 Disease resistance protein (TIR-NBS-LRR class) family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [poplar] [flax] STIR PF13676 [poplar] [flax] TIR_2 TIR domain
Representative CDS sequence Show only first row Show all	>Potri.019G098600.1 pacid=42773120 polypeptide=Potri.019G098600.1.p locus=Potri.019G098600 ID=Potri.019G098600.1.v4.1 annot-version=v4.1 ATGGCGGTGTTTTTCTTGTTTCTCTCTATCTTTTTGTTTGTTTTTATCTGGAGATTCATCTTACGAAACTGTCATCTATCTCCATCGCCATCTACTCCTT CCACCTTAACCACCGCCCAGCCACAAGTAATTAAACATGATCTCTTCCTTAGTTTCAGGGGAGAAGACACCCGTGTTGGTTTTACCAGCCACCTCTATGC TGCTTTGGACCGGAAACAAATCCGAACTTTCATAGATTATCAGCTTCGGAGAGGAGATGAGATTTCGGCATCACTTCTGAGAACAATTGAAGAGGCCAAG CTTTCTGTGATTGTTTTTTCTGAAAACTATGCATCTTCCAAATGGTGCTTGGAGGAGCTTGCAAAGATTATTGAGCGTAGAAGAAATAATGGACAGATAG TTATTCCAGTATTCTACAAGGTGGATCCATCCCATGTAAGAAATCAAACAGGAAGCTTTGGAGATGCATTGGCTAGATTGATAAAGAAGAAAGCTTTGAC GATGGACAGAGAGCAGAGCTTCAGAGACGCTTTGACGGATGCAGCCAATCTATCTGGAAGGAGCTTAGGGAATTCTTGA
AA sequence Show only first row Show all	>Potri.019G098600.1 pacid=42773120 polypeptide=Potri.019G098600.1.p locus=Potri.019G098600 ID=Potri.019G098600.1.v4.1 annot-version=v4.1 MAVFFLFLSIFLFVFIWRFILRNCHLSPSPSTPSTLTTAQPQVIKHDLFLSFRGEDTRVGFTSHLYAALDRKQIRTFIDYQLRRGDEISASLLRTIEEAK LSVIVFSENYASSKWCLEELAKIIERRRNNGQIVIPVFYKVDPSHVRNQTGSFGDALARLIKKKALTMDREQSFRDALTDAANLSGRSLGNS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G20142			Toll-Interleukin-Resistance (T...		Potri.019G098600 [exp]	0	1
AT2G34930			disease resistance family prot...		Potri.015G025100 [exp]	7.14	0.8669
AT4G11170			Disease resistance protein (TI...		Potri.019G095932 [exp]	7.93	0.8224
					Potri.001G434600 [exp]	8.83	0.8019
AT4G26485			Domain of unknown function (DU...		Potri.011G141501 [exp]	9.05	0.8230
AT4G16860		RPP5, RPP4	recognition of peronospora par...		Potri.019G097300 [exp]	10.39	0.8185
AT5G23570		SGS3, ATSGS3	SUPPRESSOR OF GENE SILENCING 3...		Potri.001G037000 [exp]	16.88	0.7929
AT4G01550	NAC	ANAC069, NTM2	NAC with Transmembrane Motif 2...		Potri.002G181800 [exp]	16.91	0.7832
AT2G04515			unknown protein		Potri.014G166900 [exp]	17.14	0.7658
AT2G17710			unknown protein		Potri.005G107900 [exp]	21.35	0.8212
AT3G44480		COG1, RPP10, RP...	recognition of peronospora par...		Potri.019G095866 [exp]	21.97	0.7882

Compare expression of checked genes

Potri.019G098600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.