Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G65690 77 / 1e-17 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT1G54540 75 / 1e-16 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) AT5G36970 71 / 2e-15 NHL25 NDR1/HIN1-like 25 (.1) AT2G27080 66 / 2e-13 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) AT5G21130 56 / 1e-09 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G135800 [exp] 190 / 1e-61 AT1G65690 112 / 4e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.017G154000 [exp] 90 / 3e-22 AT1G54540 242 / 1e-80 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.004G067100 [exp] 89 / 7e-22 AT1G54540 203 / 3e-65 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Potri.015G148200 [exp] 70 / 1e-14 AT5G36970 227 / 2e-74 NDR1/HIN1-like 25 (.1) Potri.012G145500 [exp] 67 / 1e-13 AT5G36970 238 / 2e-78 NDR1/HIN1-like 25 (.1) Potri.004G197600 [exp] 62 / 7e-12 AT2G27080 264 / 8e-89 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.009G158900 [exp] 56 / 8e-10 AT2G27080 259 / 8e-87 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1), Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.2) Potri.009G003800 [exp] 44 / 1e-05 AT5G22870 179 / 4e-57 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033705 [exp] 95 / 4e-24 AT1G65690 114 / 1e-30 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031888 [exp] 93 / 2e-23 AT1G54540 236 / 2e-78 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031317 [exp] 91 / 8e-23 AT1G54540 231 / 1e-76 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10031635 [exp] 91 / 1e-22 AT1G65690 101 / 9e-26 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1) Lus10020783 [exp] 71 / 6e-15 AT5G36970 229 / 2e-75 NDR1/HIN1-like 25 (.1) Lus10007364 [exp] 66 / 3e-13 AT1G65690 267 / 6e-90 Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.019G102500.2 pacid=42773685 polypeptide=Potri.019G102500.2.p locus=Potri.019G102500 ID=Potri.019G102500.2.v4.1 annot-version=v4.1 ATGGACTATGCTCAGCGCAGGGTGCATCCATCTGATGTTGAGGCAGCAATGGAAACTGCCCCTGCATACCCATCAAAATATGTTATGCTCAACAATAGTA ATTCTTCAAGCGTAAGGCCTCCTCCTCAAAGGCGTAACATTCCTAGCTCGGTCGTTGTAGCCTATTCAGATTCAACTCTTTGTTCTGGCAAGCTTCCTGC CTTTCACCAACCGTTCGAGAACACAACGATGATCCGTGTTGTTTTGACAGGAAAAAGCGAGTTCGGTTCAGGACTTCAAGAAGCTCTAATGGACAACAGG GAAACAGGAAGGATCCCTTTACTTGTAATCGTAAAGGCACCTATTTCTGTGATGGTTAAAAGTCTTGCATTGAGACAGGTTATGGTTAATGTCAACTGTT CTTTGGTTGTTGACAACTTGGCACCCAACAAAAGGGTTCGGATTCTATCAAGTACATATACCTATGCCTTCGAAGGTATTACGCTCAAAATATGA
AA sequence Show only first row Show all	>Potri.019G102500.2 pacid=42773685 polypeptide=Potri.019G102500.2.p locus=Potri.019G102500 ID=Potri.019G102500.2.v4.1 annot-version=v4.1 MDYAQRRVHPSDVEAAMETAPAYPSKYVMLNNSNSSSVRPPPQRRNIPSSVVVAYSDSTLCSGKLPAFHQPFENTTMIRVVLTGKSEFGSGLQEALMDNR ETGRIPLLVIVKAPISVMVKSLALRQVMVNVNCSLVVDNLAPNKRVRILSSTYTYAFEGITLKI

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G65690			Late embryogenesis abundant (L...		Potri.019G102500 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Potri.004G164600 [exp]	6.00	0.7553	SAUR68
					Potri.013G122701 [exp]	8.00	0.7541
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Potri.006G029200 [exp]	17.40	0.8318
AT3G63095			Tetratricopeptide repeat (TPR)...		Potri.002G215200 [exp]	18.52	0.6364
AT2G38600			HAD superfamily, subfamily III...		Potri.016G139700 [exp]	20.14	0.7053
AT4G27290			S-locus lectin protein kinase ...		Potri.011G125851 [exp]	24.33	0.7720
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Potri.004G200001 [exp]	40.49	0.6404
AT1G69180	YABBY	CRC	CRABS CLAW, Plant-specific tra...		Potri.010G154350 [exp]	40.55	0.7550
AT3G59850			Pectin lyase-like superfamily ...		Potri.007G144200 [exp]	44.24	0.6670
AT2G43870			Pectin lyase-like superfamily ...		Potri.010G248200 [exp]	48.37	0.7321

Compare expression of checked genes

Potri.019G102500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.